BLASTX nr result
ID: Dioscorea21_contig00025319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025319 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276935.1| PREDICTED: pentatricopeptide repeat-containi... 86 3e-15 emb|CBI26127.3| unnamed protein product [Vitis vinifera] 86 3e-15 ref|XP_002516850.1| pentatricopeptide repeat-containing protein,... 79 3e-13 ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_003629742.1| Pentatricopeptide repeat-containing protein ... 77 1e-12 >ref|XP_002276935.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial-like [Vitis vinifera] Length = 623 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/68 (57%), Positives = 55/68 (80%) Frame = -2 Query: 478 ATQALKLFDEMLERGITVDKLTFIGLLMACSHAGLVEKGKALFERMKTVHGVAPEKEHKD 299 ATQAL+L++EM+ G+ DK+TFIGLLM CSH+GL+EKG+ALFE M +V+G++ E EH Sbjct: 417 ATQALELYEEMVASGMKPDKVTFIGLLMTCSHSGLIEKGQALFESMVSVYGLSQETEHVV 476 Query: 298 CLKDMVRR 275 C+ D++ R Sbjct: 477 CMVDLLGR 484 >emb|CBI26127.3| unnamed protein product [Vitis vinifera] Length = 603 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/68 (57%), Positives = 55/68 (80%) Frame = -2 Query: 478 ATQALKLFDEMLERGITVDKLTFIGLLMACSHAGLVEKGKALFERMKTVHGVAPEKEHKD 299 ATQAL+L++EM+ G+ DK+TFIGLLM CSH+GL+EKG+ALFE M +V+G++ E EH Sbjct: 397 ATQALELYEEMVASGMKPDKVTFIGLLMTCSHSGLIEKGQALFESMVSVYGLSQETEHVV 456 Query: 298 CLKDMVRR 275 C+ D++ R Sbjct: 457 CMVDLLGR 464 >ref|XP_002516850.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543938|gb|EEF45464.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 623 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/68 (50%), Positives = 52/68 (76%) Frame = -2 Query: 478 ATQALKLFDEMLERGITVDKLTFIGLLMACSHAGLVEKGKALFERMKTVHGVAPEKEHKD 299 A++AL+L+++M+ G DK+TFIGLLM CSH+GL+E+G+ F MK+VHG++ E +H Sbjct: 417 ASEALQLYEDMMTCGTKPDKMTFIGLLMTCSHSGLIEEGRLFFNSMKSVHGLSYEADHVA 476 Query: 298 CLKDMVRR 275 C+ DM+ R Sbjct: 477 CMVDMLGR 484 >ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Vitis vinifera] Length = 647 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/69 (52%), Positives = 52/69 (75%) Frame = -2 Query: 478 ATQALKLFDEMLERGITVDKLTFIGLLMACSHAGLVEKGKALFERMKTVHGVAPEKEHKD 299 A A++LFDEML+ I +++TFIG+L ACSHAG+VE+G+ LF M+ HGVAP ++H Sbjct: 356 AGAAMELFDEMLKTEIKPNRVTFIGVLTACSHAGMVEQGQQLFAMMEECHGVAPSEDHYA 415 Query: 298 CLKDMVRRA 272 C+ D++ RA Sbjct: 416 CMVDLLGRA 424 >ref|XP_003629742.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523764|gb|AET04218.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 616 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/69 (52%), Positives = 49/69 (71%) Frame = -2 Query: 478 ATQALKLFDEMLERGITVDKLTFIGLLMACSHAGLVEKGKALFERMKTVHGVAPEKEHKD 299 A A+KLF EMLE GI + +TF+GL ACSHAG+VE+G+ LF MK +GV+P +H Sbjct: 325 ARSAIKLFYEMLENGIKPNHVTFVGLFTACSHAGMVEQGQQLFGAMKECYGVSPTADHYA 384 Query: 298 CLKDMVRRA 272 C+ D++ RA Sbjct: 385 CMADLLGRA 393