BLASTX nr result
ID: Dioscorea21_contig00025090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025090 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA47403.1| TPA: hypothetical protein ZEAMMB73_767804 [Zea m... 59 5e-07 >tpg|DAA47403.1| TPA: hypothetical protein ZEAMMB73_767804 [Zea mays] Length = 594 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +3 Query: 147 APPLPQPKCAVPKKRGSYNCGRCGLPKKGHVC 242 A P P A PK+RGSYNCGRCGLPKKGHVC Sbjct: 2 ASDAPAPAAAQPKRRGSYNCGRCGLPKKGHVC 33