BLASTX nr result
ID: Dioscorea21_contig00025016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025016 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE51773.1| hypothetical protein OsJ_33218 [Oryza sativa Japo... 56 3e-06 >gb|EEE51773.1| hypothetical protein OsJ_33218 [Oryza sativa Japonica Group] Length = 378 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 8/90 (8%) Frame = +1 Query: 7 FWLDNWLEGCAPADIWPHFFQIAPHKEETIRE-YVSRPP------EIPSSSFPDWNILLD 165 FW D WL + +P+ + I HK T+ + + + PP ++ S WN LL Sbjct: 125 FWEDKWLGNSTLKEQYPYLYNIVRHKHATVAQVFENNPPSFSWRRDLIGSKLAAWNNLLP 184 Query: 166 RLLDPHL-PARDGKTWTLTTNGRFSVKSLY 252 R+ HL +D W LT+NG FSVKS Y Sbjct: 185 RITGFHLTQEQDEFHWNLTSNGEFSVKSHY 214