BLASTX nr result
ID: Dioscorea21_contig00024401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024401 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33807.1| ty1-copia retrotransposon protein [Cucumis melo s... 79 3e-13 >gb|ADN33807.1| ty1-copia retrotransposon protein [Cucumis melo subsp. melo] Length = 1038 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +1 Query: 265 TVNKALPDLSKLEPLDGTNYKRWSQKLLIFFEQLEVDYVLFSD 393 T NK LPDLSKLEPLDGTNY+RWSQKLLIFF+QLEVDYVL +D Sbjct: 5 TSNKILPDLSKLEPLDGTNYRRWSQKLLIFFKQLEVDYVLTTD 47