BLASTX nr result
ID: Dioscorea21_contig00024233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024233 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup2... 44 8e-06 emb|CBI28192.3| unnamed protein product [Vitis vinifera] 44 8e-06 >ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup205-like [Vitis vinifera] Length = 1934 Score = 43.9 bits (102), Expect(2) = 8e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -3 Query: 118 LAAFINFVGEDHTSIQTLVATLRMCGTLNSWQ 23 L F+NF GEDHT+ QTLVA L+M GTL S Q Sbjct: 535 LWTFVNFAGEDHTNFQTLVAFLKMLGTLASSQ 566 Score = 30.4 bits (67), Expect(2) = 8e-06 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = -1 Query: 279 ERNERESYDVLSPYILVKWWDQMTLGMTPVLAHKQQARMNNQPFIPLMELVSEI*QRLLT 100 + + ++ VLSPY +V D M + ++ M +QPF+ L+E VSE+ Q+ Sbjct: 471 KETKEKAMSVLSPYRMVGSHDFMHDNNSN---SQKAVEMGSQPFVSLLEFVSEVYQKEPE 527 Query: 99 LL 94 LL Sbjct: 528 LL 529 >emb|CBI28192.3| unnamed protein product [Vitis vinifera] Length = 1889 Score = 43.9 bits (102), Expect(2) = 8e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -3 Query: 118 LAAFINFVGEDHTSIQTLVATLRMCGTLNSWQ 23 L F+NF GEDHT+ QTLVA L+M GTL S Q Sbjct: 471 LWTFVNFAGEDHTNFQTLVAFLKMLGTLASSQ 502 Score = 30.4 bits (67), Expect(2) = 8e-06 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = -1 Query: 279 ERNERESYDVLSPYILVKWWDQMTLGMTPVLAHKQQARMNNQPFIPLMELVSEI*QRLLT 100 + + ++ VLSPY +V D M + ++ M +QPF+ L+E VSE+ Q+ Sbjct: 407 KETKEKAMSVLSPYRMVGSHDFMHDNNSN---SQKAVEMGSQPFVSLLEFVSEVYQKEPE 463 Query: 99 LL 94 LL Sbjct: 464 LL 465