BLASTX nr result
ID: Dioscorea21_contig00024232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024232 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533555.1| conserved hypothetical protein [Ricinus comm... 49 6e-06 >ref|XP_002533555.1| conserved hypothetical protein [Ricinus communis] gi|223526571|gb|EEF28827.1| conserved hypothetical protein [Ricinus communis] Length = 177 Score = 48.9 bits (115), Expect(2) = 6e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 187 MSHGDTIPLHSSAQSDIDEIETLINAA 267 MSH DTIPLH+S+QSDIDEIE LINA+ Sbjct: 1 MSHSDTIPLHASSQSDIDEIENLINAS 27 Score = 25.8 bits (55), Expect(2) = 6e-06 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 261 RCPCPPRPPTKSSSRLHPNLLLALHPFQSPQQAPLRP 371 R P PPR P SS + NL Q P P P Sbjct: 39 RPPSPPRIPVSSSPFIQSNLPPPRPTSQKPPSVPAAP 75