BLASTX nr result
ID: Dioscorea21_contig00023973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023973 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002874840.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata] g... 63 3e-08 gb|EME29997.1| ferredoxin--NADP+ reductase [Galdieria sulphuraria] 60 1e-07 ref|YP_007131323.1| Ferredoxin--NADP(+) reductase [Stanieria cya... 60 2e-07 ref|YP_007108928.1| oxidoreductase FAD/NAD(P)-binding domain-con... 60 2e-07 ref|ZP_09246760.1| ferredoxin-NADP reductase PetH [Acaryochloris... 59 4e-07 >ref|XP_002874840.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata] gi|297320677|gb|EFH51099.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata] Length = 355 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/58 (53%), Positives = 41/58 (70%) Frame = -1 Query: 179 FSIASCSRGDTFDDKTLSLCVRRAGLLPDSVSNYLCNLKAGDTVEISGPSGEKMVFEE 6 +SIAS GD+FD KT SLC ++ +LP SN+LCN K GD V+I+GPSG+ M+ E Sbjct: 145 YSIASTRYGDSFDGKTASLCEKK--ILPGVCSNFLCNAKPGDKVKITGPSGKVMLLPE 200 >gb|EME29997.1| ferredoxin--NADP+ reductase [Galdieria sulphuraria] Length = 354 Score = 60.5 bits (145), Expect = 1e-07 Identities = 35/66 (53%), Positives = 39/66 (59%), Gaps = 8/66 (12%) Frame = -1 Query: 179 FSIASCSRGDTFDDKTLSLCVRRAGLLPDSV--------SNYLCNLKAGDTVEISGPSGE 24 +SIAS S GD DDKTLSLCV+R S SNYLC+LKA D V ISGP G Sbjct: 134 YSIASTSHGDHKDDKTLSLCVKRLVYTDPSTGEERRGVCSNYLCDLKANDKVNISGPVGT 193 Query: 23 KMVFEE 6 M+ E Sbjct: 194 VMLMPE 199 >ref|YP_007131323.1| Ferredoxin--NADP(+) reductase [Stanieria cyanosphaera PCC 7437] gi|428268416|gb|AFZ34357.1| Ferredoxin--NADP(+) reductase [Stanieria cyanosphaera PCC 7437] Length = 420 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 8/66 (12%) Frame = -1 Query: 179 FSIASCSRGDTFDDKTLSLCVRR-------AGLLPDSV-SNYLCNLKAGDTVEISGPSGE 24 +SIAS GD DDKT+SLCVR+ G L + V S YLCNLK GD V I+GP G+ Sbjct: 198 YSIASTRHGDAMDDKTVSLCVRKLEYQHPETGELVEGVCSTYLCNLKPGDDVAITGPVGK 257 Query: 23 KMVFEE 6 +M+ + Sbjct: 258 EMLLPD 263 >ref|YP_007108928.1| oxidoreductase FAD/NAD(P)-binding domain-containing protein [Geitlerinema sp. PCC 7407] gi|427984732|gb|AFY65876.1| oxidoreductase FAD/NAD(P)-binding domain protein [Geitlerinema sp. PCC 7407] Length = 410 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/66 (48%), Positives = 40/66 (60%), Gaps = 8/66 (12%) Frame = -1 Query: 179 FSIASCSRGDTFDDKTLSLCVRRAGLLPDSV--------SNYLCNLKAGDTVEISGPSGE 24 +SIAS GD DDKT+SLCVR+ S YLCNLKAGD V+I+GP G+ Sbjct: 186 YSIASTRHGDRVDDKTVSLCVRQLEYKSPETGETVYGVCSTYLCNLKAGDDVKITGPVGK 245 Query: 23 KMVFEE 6 +M+ E Sbjct: 246 EMLLPE 251 >ref|ZP_09246760.1| ferredoxin-NADP reductase PetH [Acaryochloris sp. CCMEE 5410] Length = 434 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 8/66 (12%) Frame = -1 Query: 179 FSIASCSRGDTFDDKTLSLCVRRAGLL-PDS-------VSNYLCNLKAGDTVEISGPSGE 24 +SIAS RGD DDKT+SLCVR+ PD+ S++LCNLK GD V+I+GP G+ Sbjct: 195 YSIASAHRGDYLDDKTVSLCVRQLEYPDPDTGKTVYGVCSSFLCNLKPGDDVKITGPVGK 254 Query: 23 KMVFEE 6 +M+ + Sbjct: 255 EMLLPD 260