BLASTX nr result
ID: Dioscorea21_contig00023916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023916 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001241603.1| uncharacterized protein LOC100812537 [Glycin... 39 6e-06 ref|XP_002302243.1| predicted protein [Populus trichocarpa] gi|2... 42 6e-06 >ref|NP_001241603.1| uncharacterized protein LOC100812537 [Glycine max] gi|255644789|gb|ACU22896.1| unknown [Glycine max] Length = 363 Score = 38.9 bits (89), Expect(2) = 6e-06 Identities = 17/35 (48%), Positives = 28/35 (80%) Frame = +3 Query: 3 SIAKVVGTILSVSGAMVMTLCKGPKIWMLCTREGT 107 S+AKV+GT+++ SGA++MTL KGP+I + + + T Sbjct: 140 SLAKVIGTLVTFSGALLMTLYKGPQIKLFFSPDTT 174 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 7/39 (17%) Frame = +1 Query: 139 LKGSIFLLVACICW-------SFTLRSYPWKLTCSFLIC 234 L G++FLL+ C+ W S TL+ YP +L+ S L+C Sbjct: 190 LSGTLFLLLGCVAWSSFFILQSITLKRYPAELSLSSLVC 228 >ref|XP_002302243.1| predicted protein [Populus trichocarpa] gi|222843969|gb|EEE81516.1| predicted protein [Populus trichocarpa] Length = 349 Score = 42.4 bits (98), Expect(2) = 6e-06 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = +3 Query: 3 SIAKVVGTILSVSGAMVMTLCKGPKIWML----CTREGTLDNGTG 125 S AKVVGT+++V+GAMVMTL KGP I + GT N +G Sbjct: 129 SAAKVVGTVITVTGAMVMTLYKGPIIDFIRSQGAAHRGTTSNASG 173 Score = 32.3 bits (72), Expect(2) = 6e-06 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 7/39 (17%) Frame = +1 Query: 139 LKGSIFLLVACICW-------SFTLRSYPWKLTCSFLIC 234 L G++ LL +C W SFTL+ YP +L+ + LIC Sbjct: 178 LTGTLMLLASCCGWASFFILQSFTLKKYPAELSLTALIC 216