BLASTX nr result
ID: Dioscorea21_contig00023709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023709 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFA77648.1| putative iron regulatory protein [Polysphondylium... 55 5e-06 >gb|EFA77648.1| putative iron regulatory protein [Polysphondylium pallidum PN500] Length = 886 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +3 Query: 3 RVHSLTRANYLASPPLVVAYALAGISRDKPFDLQRRRSSSSTGEP 137 R+H L RANYLASPPLVVAYALAG + D FD Q +SS+TG+P Sbjct: 537 RIHPLLRANYLASPPLVVAYALAG-TVDIDFDKQPIGTSSTTGKP 580