BLASTX nr result
ID: Dioscorea21_contig00023572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023572 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25132.1| unknown [Picea sitchensis] 58 9e-07 ref|XP_002461761.1| hypothetical protein SORBIDRAFT_02g007630 [S... 56 3e-06 ref|XP_004149209.1| PREDICTED: probable cytosolic iron-sulfur pr... 55 6e-06 gb|EKC28417.1| Putative cytosolic iron-sulfur protein assembly p... 55 6e-06 gb|EKC22262.1| Putative cytosolic iron-sulfur protein assembly p... 55 6e-06 >gb|ABK25132.1| unknown [Picea sitchensis] Length = 368 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +3 Query: 3 HAMDVNSVLWNPKDPQVLASASDDGSVKIWELVDVS 110 H+MDVNSV W+P +PQ+LASASDDG +KIWE+ ++ Sbjct: 327 HSMDVNSVQWHPSEPQLLASASDDGRIKIWEVTRIN 362 >ref|XP_002461761.1| hypothetical protein SORBIDRAFT_02g007630 [Sorghum bicolor] gi|241925138|gb|EER98282.1| hypothetical protein SORBIDRAFT_02g007630 [Sorghum bicolor] Length = 350 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 3 HAMDVNSVLWNPKDPQVLASASDDGSVKIWEL 98 H MD+NSV W P+DP++LASASDDG VK+WEL Sbjct: 313 HVMDINSVRWCPQDPRLLASASDDGMVKLWEL 344 >ref|XP_004149209.1| PREDICTED: probable cytosolic iron-sulfur protein assembly protein-like [Cucumis sativus] gi|449500925|ref|XP_004161232.1| PREDICTED: probable cytosolic iron-sulfur protein assembly protein-like [Cucumis sativus] Length = 350 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +3 Query: 3 HAMDVNSVLWNPKDPQVLASASDDGSVKIWELVDVS 110 H+MDVNSV W+P + +LASASDDG+++IWELV +S Sbjct: 315 HSMDVNSVQWSPGEKVLLASASDDGTIRIWELVPIS 350 >gb|EKC28417.1| Putative cytosolic iron-sulfur protein assembly protein [Crassostrea gigas] Length = 325 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 3 HAMDVNSVLWNPKDPQVLASASDDGSVKIWELV 101 H+ DVNSV WNPK+P +LAS SDDG VK+W++V Sbjct: 291 HSQDVNSVAWNPKEPGLLASGSDDGDVKLWKVV 323 >gb|EKC22262.1| Putative cytosolic iron-sulfur protein assembly protein [Crassostrea gigas] Length = 334 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 3 HAMDVNSVLWNPKDPQVLASASDDGSVKIWELV 101 H+ DVNSV WNPK+P +LAS SDDG VK+W++V Sbjct: 300 HSQDVNSVAWNPKEPGLLASGSDDGDVKLWKVV 332