BLASTX nr result
ID: Dioscorea21_contig00023551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023551 (1297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308507.1| predicted protein [Populus trichocarpa] gi|2... 61 6e-07 emb|CBI20749.3| unnamed protein product [Vitis vinifera] 60 1e-06 ref|XP_002516170.1| hypothetical protein RCOM_0708150 [Ricinus c... 60 2e-06 >ref|XP_002308507.1| predicted protein [Populus trichocarpa] gi|222854483|gb|EEE92030.1| predicted protein [Populus trichocarpa] Length = 320 Score = 61.2 bits (147), Expect = 6e-07 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 1152 KMQEEPQLSGAYIRSLVKQLSSSRTKEPMNPRSPNTVLGDELSQD 1286 K++EEP LSGAYIRSLVKQL+SSRTK+PMNP+ + D LS++ Sbjct: 8 KLKEEPHLSGAYIRSLVKQLTSSRTKDPMNPKGHGSADSDGLSKN 52 >emb|CBI20749.3| unnamed protein product [Vitis vinifera] Length = 290 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +3 Query: 1134 MEVER-SKMQEEPQLSGAYIRSLVKQLSSSRTKEPMNPRSPNT 1259 M++++ K++EEP LSGAYIRSLVKQL+SSRTK+PMNP+ +T Sbjct: 1 MDIDKIHKLKEEPHLSGAYIRSLVKQLTSSRTKDPMNPKDSDT 43 >ref|XP_002516170.1| hypothetical protein RCOM_0708150 [Ricinus communis] gi|223544656|gb|EEF46172.1| hypothetical protein RCOM_0708150 [Ricinus communis] Length = 425 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +3 Query: 1134 MEVER-SKMQEEPQLSGAYIRSLVKQLSSSRTKEPMNPRSPNTVLGDELS 1280 ME+++ +K++EEP LSGAYIRSLVKQL+SSRTK+PMN + + V D S Sbjct: 14 MEIDKLNKLKEEPHLSGAYIRSLVKQLTSSRTKDPMNSKDRSCVDDDSFS 63