BLASTX nr result
ID: Dioscorea21_contig00023539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023539 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH09315.1| 50S ribosomal protein L22 [Stemona aphylla] gi|2... 61 1e-07 dbj|BAG06411.1| ribosomal protein L22 [Sagittaria trifolia] 58 9e-07 gb|AEZ49247.1| ribosomal protein L22, partial [Albuca kirkii] 57 2e-06 gb|ABU85461.1| ribosomal protein L22 [Musa acuminata] 56 4e-06 ref|YP_007476001.1| ribosomal protein L22 [Bismarckia nobilis] g... 55 8e-06 >dbj|BAH09315.1| 50S ribosomal protein L22 [Stemona aphylla] gi|219687629|dbj|BAH09327.1| 50S ribosomal protein L22 [Stemona sp. Shut-0001] gi|219687633|dbj|BAH09330.1| 50S ribosomal protein L22 [Stemona phyllantha] gi|256016930|dbj|BAH97247.1| ribosomal protein L22 [Stemona parviflora] Length = 128 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 159 SEGRSYPVKKPTCYITIVLKDKSKSFLNESKI 64 + GRSYP+KKPTC+ITIVLK+KSKSFLNESKI Sbjct: 97 ARGRSYPIKKPTCHITIVLKEKSKSFLNESKI 128 >dbj|BAG06411.1| ribosomal protein L22 [Sagittaria trifolia] Length = 128 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 159 SEGRSYPVKKPTCYITIVLKDKSKSFLNESKI 64 + GRSYP+KKPTC+ITI+LKDKSKSFLNE I Sbjct: 97 ARGRSYPIKKPTCHITIILKDKSKSFLNEFNI 128 >gb|AEZ49247.1| ribosomal protein L22, partial [Albuca kirkii] Length = 130 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 159 SEGRSYPVKKPTCYITIVLKDKSKSFLNESKI 64 + GRSYP+K+PTC+ITIVLKDKSK FL+ESK+ Sbjct: 99 ARGRSYPIKRPTCHITIVLKDKSKLFLDESKV 130 >gb|ABU85461.1| ribosomal protein L22 [Musa acuminata] Length = 129 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 159 SEGRSYPVKKPTCYITIVLKDKSKSFLNESKI 64 + GRSYP+K+PTC+ITIVLKDKSK FL+ES+I Sbjct: 98 ARGRSYPIKRPTCHITIVLKDKSKLFLDESRI 129 >ref|YP_007476001.1| ribosomal protein L22 [Bismarckia nobilis] gi|449326483|gb|AGE93065.1| ribosomal protein L22 [Bismarckia nobilis] Length = 108 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 216 AYLQLQQVKRIKQVK*ISS-SEGRSYPVKKPTCYITIVLKDKSKSFLNES 70 +++ +V R VK + + GRSYP+KKPTC+ITIVLK+KSKSFL++S Sbjct: 58 SFISKAEVNRSAIVKKLRPRARGRSYPIKKPTCHITIVLKEKSKSFLDQS 107