BLASTX nr result
ID: Dioscorea21_contig00022848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00022848 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308415.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002325118.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002528401.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_004144719.1| PREDICTED: uncharacterized protein LOC101216... 55 5e-06 >ref|XP_002308415.1| predicted protein [Populus trichocarpa] gi|222854391|gb|EEE91938.1| predicted protein [Populus trichocarpa] Length = 1157 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -3 Query: 347 GMASNPYNLPIGCEYYLVTVAMLPD-TIHSSP 255 G SNPYNLPIGCEY++VTVAMLPD TIHS+P Sbjct: 1124 GPTSNPYNLPIGCEYFVVTVAMLPDSTIHSAP 1155 >ref|XP_002325118.1| predicted protein [Populus trichocarpa] gi|222866552|gb|EEF03683.1| predicted protein [Populus trichocarpa] Length = 1153 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -3 Query: 347 GMASNPYNLPIGCEYYLVTVAMLPD-TIHSSP 255 G SNPYNLP+GCEY++VTVAMLPD TIHS+P Sbjct: 1120 GSTSNPYNLPMGCEYFVVTVAMLPDTTIHSAP 1151 >ref|XP_002528401.1| conserved hypothetical protein [Ricinus communis] gi|223532189|gb|EEF33994.1| conserved hypothetical protein [Ricinus communis] Length = 1145 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -3 Query: 347 GMASNPYNLPIGCEYYLVTVAMLPD-TIHSSP 255 G +SNPYNLPIGCEY++VTVAMLPD TI SSP Sbjct: 1112 GSSSNPYNLPIGCEYFVVTVAMLPDTTIRSSP 1143 >ref|XP_004144719.1| PREDICTED: uncharacterized protein LOC101216810 [Cucumis sativus] gi|449518296|ref|XP_004166178.1| PREDICTED: uncharacterized LOC101216810 [Cucumis sativus] Length = 1152 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/34 (70%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -3 Query: 356 LSPGMASNPYNLPIGCEYYLVTVAMLPDT-IHSS 258 L+ G++SNPY LP+GCEY++VTVAMLPDT IHS+ Sbjct: 1117 LNSGLSSNPYGLPVGCEYFIVTVAMLPDTAIHST 1150