BLASTX nr result
ID: Dioscorea21_contig00022800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00022800 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003563556.1| PREDICTED: ribosomal RNA large subunit methy... 55 5e-06 ref|XP_002531569.1| ftsj, putative [Ricinus communis] gi|2235287... 55 6e-06 >ref|XP_003563556.1| PREDICTED: ribosomal RNA large subunit methyltransferase E-like [Brachypodium distachyon] Length = 234 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 261 CKSRFKKASMLRPKATRSCSREIYLICQGLK 169 CK +FKK S+LRPKATRS SREIYLIC+GL+ Sbjct: 204 CKEKFKKVSLLRPKATRSSSREIYLICEGLR 234 >ref|XP_002531569.1| ftsj, putative [Ricinus communis] gi|223528799|gb|EEF30805.1| ftsj, putative [Ricinus communis] Length = 228 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 261 CKSRFKKASMLRPKATRSCSREIYLICQGLK 169 CK F+KAS LRPKATRS SREIYLICQGLK Sbjct: 198 CKPLFRKASWLRPKATRSSSREIYLICQGLK 228