BLASTX nr result
ID: Dioscorea21_contig00022536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00022536 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI18976.1| nuclear-localized RNA binding protein [Capsicum a... 57 2e-06 >gb|ABI18976.1| nuclear-localized RNA binding protein [Capsicum annuum] Length = 360 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 6/53 (11%) Frame = +2 Query: 143 MASSNPFDILGGDDNDDPSHLIVVHQQQAA-SKNPSVSSAA-----DKLPSKP 283 MA NPFD+LG DD DDPS LI +HQQ+AA +K PS +AA KLP+KP Sbjct: 1 MADLNPFDLLGDDDTDDPSKLIAIHQQKAAPTKKPSGPAAAAKKQPAKLPTKP 53