BLASTX nr result
ID: Dioscorea21_contig00022351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00022351 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW73049.1| kinesin light chain [Zea mays] 105 5e-21 ref|NP_001147329.1| kinesin light chain [Zea mays] gi|195609980|... 105 5e-21 ref|NP_001130826.1| uncharacterized protein LOC100191930 [Zea ma... 105 5e-21 gb|ABF70142.1| glycoside hydrolase family 17 protein [Musa balbi... 103 1e-20 gb|ABF70051.1| kinesin light chain-related [Musa acuminata] 103 1e-20 >gb|AFW73049.1| kinesin light chain [Zea mays] Length = 713 Score = 105 bits (261), Expect = 5e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -3 Query: 263 EAIEILEYVVGIREEKLGTANPVVDDEKRRLAELLKEAGKVRSRKARSLETLLDTNPYIL 84 EAIEILEYVVG+REEKLGTANP VDDEKRRL ELLKEAG+VRSRKA+SLE LL+TNPYI Sbjct: 646 EAIEILEYVVGMREEKLGTANPDVDDEKRRLGELLKEAGRVRSRKAKSLENLLETNPYIA 705 Query: 83 KK 78 K Sbjct: 706 TK 707 >ref|NP_001147329.1| kinesin light chain [Zea mays] gi|195609980|gb|ACG26820.1| kinesin light chain [Zea mays] Length = 713 Score = 105 bits (261), Expect = 5e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -3 Query: 263 EAIEILEYVVGIREEKLGTANPVVDDEKRRLAELLKEAGKVRSRKARSLETLLDTNPYIL 84 EAIEILEYVVG+REEKLGTANP VDDEKRRL ELLKEAG+VRSRKA+SLE LL+TNPYI Sbjct: 646 EAIEILEYVVGMREEKLGTANPDVDDEKRRLGELLKEAGRVRSRKAKSLENLLETNPYIA 705 Query: 83 KK 78 K Sbjct: 706 TK 707 >ref|NP_001130826.1| uncharacterized protein LOC100191930 [Zea mays] gi|194690216|gb|ACF79192.1| unknown [Zea mays] gi|413923632|gb|AFW63564.1| hypothetical protein ZEAMMB73_255866 [Zea mays] Length = 713 Score = 105 bits (261), Expect = 5e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -3 Query: 263 EAIEILEYVVGIREEKLGTANPVVDDEKRRLAELLKEAGKVRSRKARSLETLLDTNPYIL 84 EAIEILEYVVG+REEKLGTANP VDDEKRRL ELLKEAG+VRSRKA+SLE LL+TNPYI Sbjct: 646 EAIEILEYVVGMREEKLGTANPDVDDEKRRLGELLKEAGRVRSRKAKSLENLLETNPYIA 705 Query: 83 KK 78 K Sbjct: 706 TK 707 >gb|ABF70142.1| glycoside hydrolase family 17 protein [Musa balbisiana] Length = 715 Score = 103 bits (257), Expect = 1e-20 Identities = 52/63 (82%), Positives = 57/63 (90%) Frame = -3 Query: 263 EAIEILEYVVGIREEKLGTANPVVDDEKRRLAELLKEAGKVRSRKARSLETLLDTNPYIL 84 EAIEILEYVVGIREE LGTANP VDDEKRRLAELLKEAG+VR+RK RSLETLLD NP+ + Sbjct: 647 EAIEILEYVVGIREENLGTANPEVDDEKRRLAELLKEAGRVRNRKPRSLETLLDKNPHAM 706 Query: 83 KKD 75 K+ Sbjct: 707 NKN 709 >gb|ABF70051.1| kinesin light chain-related [Musa acuminata] Length = 715 Score = 103 bits (257), Expect = 1e-20 Identities = 52/63 (82%), Positives = 57/63 (90%) Frame = -3 Query: 263 EAIEILEYVVGIREEKLGTANPVVDDEKRRLAELLKEAGKVRSRKARSLETLLDTNPYIL 84 EAIEILEYVVGIREE LGTANP VDDEKRRLAELLKEAG+VR+RK RSLETLLD NP+ + Sbjct: 647 EAIEILEYVVGIREENLGTANPEVDDEKRRLAELLKEAGRVRNRKPRSLETLLDKNPHAI 706 Query: 83 KKD 75 K+ Sbjct: 707 NKN 709