BLASTX nr result
ID: Dioscorea21_contig00022093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00022093 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299485.1| proline transporter [Populus trichocarpa] gi... 152 4e-35 ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [V... 150 1e-34 ref|XP_002303637.1| proline transporter [Populus trichocarpa] gi... 150 1e-34 ref|XP_003517498.1| PREDICTED: lysine histidine transporter 1-li... 147 7e-34 ref|XP_002509935.1| amino acid transporter, putative [Ricinus co... 145 3e-33 >ref|XP_002299485.1| proline transporter [Populus trichocarpa] gi|222846743|gb|EEE84290.1| proline transporter [Populus trichocarpa] Length = 453 Score = 152 bits (383), Expect = 4e-35 Identities = 72/90 (80%), Positives = 80/90 (88%) Frame = +3 Query: 3 GTFSKRNLIPRIILRTLYMIFCGFVAAMLPFFGDVIGVVGAIGFIPLDFILPMLLYNMAI 182 G FSKRNLIPRI+LRTLYMIFCGF+AAMLPFFGD+ GVVGAIGFIPLDF+LPMLLYNM Sbjct: 344 GMFSKRNLIPRIVLRTLYMIFCGFMAAMLPFFGDINGVVGAIGFIPLDFVLPMLLYNMTF 403 Query: 183 KPPTRSVMFLLNMFIMVVFTGVGIMGAFSS 272 KPP S+ + LN+ IMVVFTG G+MGAFSS Sbjct: 404 KPPKSSLTYWLNLSIMVVFTGAGLMGAFSS 433 >ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera] gi|297742313|emb|CBI34462.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 150 bits (379), Expect = 1e-34 Identities = 73/91 (80%), Positives = 81/91 (89%) Frame = +3 Query: 3 GTFSKRNLIPRIILRTLYMIFCGFVAAMLPFFGDVIGVVGAIGFIPLDFILPMLLYNMAI 182 G FSKRNLIPRIILRTLYMIFCGF+AAMLPFFGD+ GVVGAIGFIPLDFILPMLLYNM Sbjct: 346 GLFSKRNLIPRIILRTLYMIFCGFMAAMLPFFGDINGVVGAIGFIPLDFILPMLLYNMTH 405 Query: 183 KPPTRSVMFLLNMFIMVVFTGVGIMGAFSSI 275 KPP S+M+ +N+ I++VFT GIMGAFSSI Sbjct: 406 KPPRSSLMYWINISIIIVFTDAGIMGAFSSI 436 >ref|XP_002303637.1| proline transporter [Populus trichocarpa] gi|222841069|gb|EEE78616.1| proline transporter [Populus trichocarpa] Length = 453 Score = 150 bits (378), Expect = 1e-34 Identities = 70/91 (76%), Positives = 82/91 (90%) Frame = +3 Query: 3 GTFSKRNLIPRIILRTLYMIFCGFVAAMLPFFGDVIGVVGAIGFIPLDFILPMLLYNMAI 182 G FS+RNLIPR+ILRTLYMIFCGF+AAMLPFFGD+ GVVGAIGFIPLDF+LPMLLYNM Sbjct: 344 GMFSRRNLIPRLILRTLYMIFCGFMAAMLPFFGDINGVVGAIGFIPLDFVLPMLLYNMTY 403 Query: 183 KPPTRSVMFLLNMFIMVVFTGVGIMGAFSSI 275 KPP S+++ +N+ IMVVFTG G+MGAFSS+ Sbjct: 404 KPPKSSLIYWVNLSIMVVFTGAGLMGAFSSM 434 >ref|XP_003517498.1| PREDICTED: lysine histidine transporter 1-like [Glycine max] Length = 441 Score = 147 bits (372), Expect = 7e-34 Identities = 71/91 (78%), Positives = 79/91 (86%) Frame = +3 Query: 3 GTFSKRNLIPRIILRTLYMIFCGFVAAMLPFFGDVIGVVGAIGFIPLDFILPMLLYNMAI 182 G FSKRNLIPRIILR++YMI CG+VAAMLPFFGD+ GVVGAIGFIPLDF+LPML+YNM Sbjct: 332 GMFSKRNLIPRIILRSIYMILCGYVAAMLPFFGDINGVVGAIGFIPLDFVLPMLMYNMTY 391 Query: 183 KPPTRSVMFLLNMFIMVVFTGVGIMGAFSSI 275 KPP S + +N IMVVFTGVGIMGAFSSI Sbjct: 392 KPPKSSFTYWINTSIMVVFTGVGIMGAFSSI 422 >ref|XP_002509935.1| amino acid transporter, putative [Ricinus communis] gi|223549834|gb|EEF51322.1| amino acid transporter, putative [Ricinus communis] Length = 452 Score = 145 bits (367), Expect = 3e-33 Identities = 70/91 (76%), Positives = 80/91 (87%) Frame = +3 Query: 3 GTFSKRNLIPRIILRTLYMIFCGFVAAMLPFFGDVIGVVGAIGFIPLDFILPMLLYNMAI 182 G FSKRNLIPR+ILRTLY+IFCGF+AAMLPFFGD+ GVVGAIGFIPLDF+LPMLLYNM Sbjct: 343 GMFSKRNLIPRLILRTLYVIFCGFMAAMLPFFGDINGVVGAIGFIPLDFVLPMLLYNMTY 402 Query: 183 KPPTRSVMFLLNMFIMVVFTGVGIMGAFSSI 275 KP S+ + +N+ I+VVFTG GIMGAFSSI Sbjct: 403 KPRRSSLTYWINISIIVVFTGAGIMGAFSSI 433