BLASTX nr result
ID: Dioscorea21_contig00022059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00022059 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW22873.1| putative polyprotein [Solanum lycopersicum] 55 5e-06 >gb|AAW22873.1| putative polyprotein [Solanum lycopersicum] Length = 687 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +3 Query: 18 H*LRMVIEEQEMKLKEIHTDNNAVDMLTKMTSREKLKLCSSLDGMHS 158 H LR+VI+E+ MKLK+IHT+ N DMLTK+ KL+ CS L GM S Sbjct: 641 HWLRVVIKERLMKLKKIHTNKNGADMLTKVVPGSKLEFCSKLAGMSS 687