BLASTX nr result
ID: Dioscorea21_contig00021885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00021885 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC79355.1| hypothetical protein OsI_20233 [Oryza sativa Indi... 57 2e-06 ref|XP_002873421.1| ribosomal protein L17 family protein [Arabid... 56 4e-06 >gb|EEC79355.1| hypothetical protein OsI_20233 [Oryza sativa Indica Group] Length = 161 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +1 Query: 1 PQPPQRTPLDPWKKSQASKQWASPKEEKTSGSE 99 PQPPQR PLDPW KS ASKQWA PK + SG+E Sbjct: 127 PQPPQRVPLDPWTKSLASKQWAGPKISQNSGAE 159 >ref|XP_002873421.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. lyrata] gi|297319258|gb|EFH49680.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. lyrata] Length = 160 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +1 Query: 1 PQPPQRTPLDPWKKSQASKQWASPKEEKTSGSE 99 PQPPQR PLDPW++S+ +KQ+A PKEEK+S SE Sbjct: 127 PQPPQRVPLDPWERSRLTKQFAPPKEEKSSDSE 159