BLASTX nr result
ID: Dioscorea21_contig00021683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00021683 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275327.1| PREDICTED: protein CASP [Vitis vinifera] 59 4e-07 ref|XP_003630836.1| Protein CASP [Medicago truncatula] gi|355524... 55 8e-06 >ref|XP_002275327.1| PREDICTED: protein CASP [Vitis vinifera] Length = 684 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 4/45 (8%) Frame = -1 Query: 124 MDHSQSSSDRDKP----GAPIAAVSSFWREFDLEKERSGLDEQGL 2 M+ Q SDRDKP +PI VS+FWREFDLEKERS LDEQGL Sbjct: 1 MEAPQGGSDRDKPMPASSSPIPVVSNFWREFDLEKERSVLDEQGL 45 >ref|XP_003630836.1| Protein CASP [Medicago truncatula] gi|355524858|gb|AET05312.1| Protein CASP [Medicago truncatula] Length = 683 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -1 Query: 124 MDHSQSSSDRDKPGAPIAAVSSFWREFDLEKERSGLDEQGL 2 M+ S S+RD +PI+ VS+FW++FDLEKE+S LDEQGL Sbjct: 1 MESPPSGSERDTTNSPISVVSAFWKDFDLEKEKSVLDEQGL 41