BLASTX nr result
ID: Dioscorea21_contig00021611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00021611 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38716.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002266192.1| PREDICTED: two-component response regulator-... 71 1e-10 gb|AFW65087.1| hypothetical protein ZEAMMB73_389889 [Zea mays] 70 2e-10 ref|XP_003528765.1| PREDICTED: two-component response regulator-... 70 2e-10 ref|XP_003528764.1| PREDICTED: two-component response regulator-... 70 2e-10 >emb|CBI38716.3| unnamed protein product [Vitis vinifera] Length = 593 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 VLKCMLKGAVDFLVKPVRKNELQNLWQHVWRKH 99 VLKCMLKGA DFLVKPVRKNEL+NLWQHVWR+H Sbjct: 93 VLKCMLKGAADFLVKPVRKNELRNLWQHVWRRH 125 >ref|XP_002266192.1| PREDICTED: two-component response regulator-like APRR5-like [Vitis vinifera] Length = 641 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 VLKCMLKGAVDFLVKPVRKNELQNLWQHVWRKH 99 VLKCMLKGA DFLVKPVRKNEL+NLWQHVWR+H Sbjct: 141 VLKCMLKGAADFLVKPVRKNELRNLWQHVWRRH 173 >gb|AFW65087.1| hypothetical protein ZEAMMB73_389889 [Zea mays] Length = 319 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 VLKCMLKGAVDFLVKPVRKNELQNLWQHVWRKH 99 VLKCM KGAVDFLVKPVRKNEL+NLWQHVWR+H Sbjct: 58 VLKCMQKGAVDFLVKPVRKNELRNLWQHVWRRH 90 >ref|XP_003528765.1| PREDICTED: two-component response regulator-like PRR95-like isoform 2 [Glycine max] Length = 722 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 4 LKCMLKGAVDFLVKPVRKNELQNLWQHVWRKH 99 LKCMLKGAVDFL+KP+RKNEL+NLWQHVWR+H Sbjct: 120 LKCMLKGAVDFLIKPIRKNELRNLWQHVWRRH 151 >ref|XP_003528764.1| PREDICTED: two-component response regulator-like PRR95-like isoform 1 [Glycine max] Length = 703 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 4 LKCMLKGAVDFLVKPVRKNELQNLWQHVWRKH 99 LKCMLKGAVDFL+KP+RKNEL+NLWQHVWR+H Sbjct: 120 LKCMLKGAVDFLIKPIRKNELRNLWQHVWRRH 151