BLASTX nr result
ID: Dioscorea21_contig00021342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00021342 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22522.1| unknown [Picea sitchensis] 58 7e-07 ref|XP_003577126.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-l... 57 2e-06 >gb|ABK22522.1| unknown [Picea sitchensis] Length = 162 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 104 ETYKFGPYKISGSEVFFRTELSFAFVNLRPVVPG 3 E Y FGPYKI +EVFF TELSFA VNLRPVVPG Sbjct: 10 EVYYFGPYKIEKNEVFFTTELSFALVNLRPVVPG 43 >ref|XP_003577126.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Brachypodium distachyon] Length = 162 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -3 Query: 113 PEPETYKFGPYKISGSEVFFRTELSFAFVNLRPVVPG 3 PE E YKFGPYKI EVF T LS+A VNLRP++PG Sbjct: 6 PETEAYKFGPYKIDAREVFHATPLSYAMVNLRPLLPG 42