BLASTX nr result
ID: Dioscorea21_contig00021284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00021284 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513464.1| serine/threonine protein kinase, putative [R... 57 2e-06 >ref|XP_002513464.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223547372|gb|EEF48867.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 440 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 6/55 (10%) Frame = +1 Query: 70 ADGEEPKQKDLHFDNLRAIRVLGRGAMGTVFLTDD------ASQPFALKVFDKKS 216 A E P +L+FDNLRAI+VLG+GAMGTVFL D A P+ALKV +K + Sbjct: 25 AHQEPPSLPELNFDNLRAIKVLGKGAMGTVFLVHDRAADPGAKNPYALKVVEKST 79