BLASTX nr result
ID: Dioscorea21_contig00021029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00021029 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA57010.1| TPA: electron transporter [Zea mays] 108 4e-22 gb|ACR38265.1| unknown [Zea mays] 108 4e-22 gb|ACN26013.1| unknown [Zea mays] 108 4e-22 ref|NP_001151099.1| electron transporter [Zea mays] gi|195644312... 108 6e-22 ref|XP_002456578.1| hypothetical protein SORBIDRAFT_03g038700 [S... 104 7e-21 >tpg|DAA57010.1| TPA: electron transporter [Zea mays] Length = 289 Score = 108 bits (271), Expect = 4e-22 Identities = 51/71 (71%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Frame = -3 Query: 220 IRQLHEAGELRRLVEGAPPAG-ATCDRCGGSSFVLCWACNGSHKRFSEK--SGFRSCAAC 50 +R+LHEAGELRR+V GA A ATC RCGG +VLC +CNGSHKR+S K SGFR+CA C Sbjct: 214 VRRLHEAGELRRVVAGAVAASLATCGRCGGERYVLCGSCNGSHKRYSAKGGSGFRTCAVC 273 Query: 49 NENGLVRCPDC 17 NENGLVRCPDC Sbjct: 274 NENGLVRCPDC 284 >gb|ACR38265.1| unknown [Zea mays] Length = 236 Score = 108 bits (271), Expect = 4e-22 Identities = 51/71 (71%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Frame = -3 Query: 220 IRQLHEAGELRRLVEGAPPAG-ATCDRCGGSSFVLCWACNGSHKRFSEK--SGFRSCAAC 50 +R+LHEAGELRR+V GA A ATC RCGG +VLC +CNGSHKR+S K SGFR+CA C Sbjct: 161 VRRLHEAGELRRVVAGAVAASLATCGRCGGERYVLCGSCNGSHKRYSAKGGSGFRTCAVC 220 Query: 49 NENGLVRCPDC 17 NENGLVRCPDC Sbjct: 221 NENGLVRCPDC 231 >gb|ACN26013.1| unknown [Zea mays] Length = 256 Score = 108 bits (271), Expect = 4e-22 Identities = 51/71 (71%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Frame = -3 Query: 220 IRQLHEAGELRRLVEGAPPAG-ATCDRCGGSSFVLCWACNGSHKRFSEK--SGFRSCAAC 50 +R+LHEAGELRR+V GA A ATC RCGG +VLC +CNGSHKR+S K SGFR+CA C Sbjct: 181 VRRLHEAGELRRVVAGAVAASLATCGRCGGERYVLCGSCNGSHKRYSAKGGSGFRTCAVC 240 Query: 49 NENGLVRCPDC 17 NENGLVRCPDC Sbjct: 241 NENGLVRCPDC 251 >ref|NP_001151099.1| electron transporter [Zea mays] gi|195644312|gb|ACG41624.1| electron transporter [Zea mays] Length = 256 Score = 108 bits (269), Expect = 6e-22 Identities = 51/71 (71%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Frame = -3 Query: 220 IRQLHEAGELRRLVEGAPPAG-ATCDRCGGSSFVLCWACNGSHKRFSEK--SGFRSCAAC 50 +R+LHEAGELRR+V GA A ATC RCGG +VLC +CNGSHKR+S K SGFR+CA C Sbjct: 181 VRRLHEAGELRRVVAGAVAASLATCVRCGGERYVLCGSCNGSHKRYSAKGGSGFRTCAVC 240 Query: 49 NENGLVRCPDC 17 NENGLVRCPDC Sbjct: 241 NENGLVRCPDC 251 >ref|XP_002456578.1| hypothetical protein SORBIDRAFT_03g038700 [Sorghum bicolor] gi|241928553|gb|EES01698.1| hypothetical protein SORBIDRAFT_03g038700 [Sorghum bicolor] Length = 265 Score = 104 bits (260), Expect = 7e-21 Identities = 49/72 (68%), Positives = 56/72 (77%), Gaps = 4/72 (5%) Frame = -3 Query: 220 IRQLHEAGELRRLVEGAPPAG--ATCDRCGGSSFVLCWACNGSHKRFSEK--SGFRSCAA 53 +R+LHEAGELRR+V GA A A C RCGG +VLC +CNGSHKR+S K GFR+CA Sbjct: 189 VRRLHEAGELRRVVAGAVAASSLAVCGRCGGERYVLCGSCNGSHKRYSVKGGGGFRTCAG 248 Query: 52 CNENGLVRCPDC 17 CNENGLVRCPDC Sbjct: 249 CNENGLVRCPDC 260