BLASTX nr result
ID: Dioscorea21_contig00020869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020869 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595075.1| Poly(rC)-binding protein [Medicago truncatul... 58 9e-07 >ref|XP_003595075.1| Poly(rC)-binding protein [Medicago truncatula] gi|355484123|gb|AES65326.1| Poly(rC)-binding protein [Medicago truncatula] Length = 470 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/63 (44%), Positives = 40/63 (63%) Frame = -3 Query: 189 QDHPVDTWGDKTQSSGYSTQQTMMGDDYPAPMKRTSLFIDHDSHLESQISRSSLSLYGPE 10 QD +TW DK ++T QT M D P P KR S+F D +SHL+S +S S++SLYG + Sbjct: 258 QDRQAETWSDKPLL--HTTSQTSMFSDIPFPTKRDSVFADRESHLDSLLSSSTMSLYGQD 315 Query: 9 PAV 1 ++ Sbjct: 316 SSL 318