BLASTX nr result
ID: Dioscorea21_contig00020731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020731 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279218.2| PREDICTED: receptor-like protein kinase FERO... 66 3e-09 ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago trunc... 64 1e-08 ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glyc... 64 1e-08 ref|NP_001238686.1| receptor-like kinase [Glycine max] gi|223452... 64 1e-08 ref|XP_002528705.1| kinase, putative [Ricinus communis] gi|22353... 64 1e-08 >ref|XP_002279218.2| PREDICTED: receptor-like protein kinase FERONIA-like, partial [Vitis vinifera] Length = 481 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 TMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 96 TMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 450 TMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 481 >ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula] gi|355510153|gb|AES91295.1| FERONIA receptor-like kinase [Medicago truncatula] Length = 893 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 TMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 96 +MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 862 SMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max] gi|223452393|gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max] Length = 892 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 TMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 96 +MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 861 SMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 892 >ref|NP_001238686.1| receptor-like kinase [Glycine max] gi|223452309|gb|ACM89482.1| receptor-like kinase [Glycine max] Length = 883 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 TMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 96 +MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 852 SMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 883 >ref|XP_002528705.1| kinase, putative [Ricinus communis] gi|223531877|gb|EEF33694.1| kinase, putative [Ricinus communis] Length = 891 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 TMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 96 +MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 860 SMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891