BLASTX nr result
ID: Dioscorea21_contig00020628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020628 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283047.1| PREDICTED: IAA-amino acid hydrolase ILR1-lik... 64 1e-08 emb|CAN61999.1| hypothetical protein VITISV_007874 [Vitis vinifera] 63 2e-08 ref|XP_002303219.1| iaa-amino acid hydrolase 11 [Populus trichoc... 63 3e-08 ref|XP_002515893.1| IAA-amino acid hydrolase ILR1 precursor, put... 62 5e-08 ref|XP_003597383.1| IAA-amino acid hydrolase ILR1-like protein [... 62 6e-08 >ref|XP_002283047.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera] Length = 439 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = +1 Query: 1 NESHPPLKAGHSPHYEVNEEVLPYGAALHAALAFEYLSKAQIPLM--EKERVHDEL 162 NE+ L+ GH+P+Y VNE+ LPYGAALHA+LA YL + Q P++ KE +HDEL Sbjct: 384 NETRGQLELGHTPYYTVNEDALPYGAALHASLATRYLLEYQQPIITSPKESLHDEL 439 >emb|CAN61999.1| hypothetical protein VITISV_007874 [Vitis vinifera] Length = 416 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = +1 Query: 1 NESHPPLKAGHSPHYEVNEEVLPYGAALHAALAFEYLSKAQIPLM--EKERVHDEL 162 NE+ L+ GH P+Y VNE+ LPYGAALHA+LA YL + Q P++ KE +HDEL Sbjct: 361 NETRGQLELGHXPYYTVNEDALPYGAALHASLATRYLLEYQQPIITSPKESLHDEL 416 >ref|XP_002303219.1| iaa-amino acid hydrolase 11 [Populus trichocarpa] gi|222840651|gb|EEE78198.1| iaa-amino acid hydrolase 11 [Populus trichocarpa] Length = 438 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/55 (54%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +1 Query: 1 NESHPPLKAGHSPHYEVNEEVLPYGAALHAALAFEYLSKAQIPL-MEKERVHDEL 162 NE+H L++ HSP++E+NE+VLPYGAALHA+LA YL + Q + + +E HDEL Sbjct: 384 NETHKQLQSPHSPYFEINEDVLPYGAALHASLAARYLLEFQPEVTLPEENDHDEL 438 >ref|XP_002515893.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis] gi|223544798|gb|EEF46313.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis] Length = 435 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 4/58 (6%) Frame = +1 Query: 1 NESHPPLKAGHSPHYEVNEEVLPYGAALHAALAFEYLSKAQ----IPLMEKERVHDEL 162 NE+ L++ HSPH+E+NE+VLPYGAALHA+LA YL Q +P+ E+ HDEL Sbjct: 381 NETRKKLQSAHSPHFEINEDVLPYGAALHASLATRYLLNLQPEHPLPV---EKYHDEL 435 >ref|XP_003597383.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula] gi|355486431|gb|AES67634.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula] Length = 447 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = +1 Query: 19 LKAGHSPHYEVNEEVLPYGAALHAALAFEYLSK--AQIPLMEKERVHDEL 162 L +GHSP+Y+VNE+ LPYGAALHA+LA YL K ++P++E+ ++HDEL Sbjct: 399 LPSGHSPYYKVNEDALPYGAALHASLASRYLVKLHQEVPVVER-KIHDEL 447