BLASTX nr result
ID: Dioscorea21_contig00020600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020600 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] 121 7e-26 ref|NP_001239836.1| uncharacterized protein LOC100812839 [Glycin... 120 9e-26 ref|XP_002516875.1| zinc finger protein, putative [Ricinus commu... 120 9e-26 ref|NP_001241502.1| uncharacterized protein LOC100792038 [Glycin... 120 1e-25 ref|XP_002312758.1| predicted protein [Populus trichocarpa] gi|2... 119 2e-25 >gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] Length = 109 Score = 121 bits (303), Expect = 7e-26 Identities = 50/61 (81%), Positives = 57/61 (93%) Frame = +2 Query: 2 REIDEEIESTIMPEDYRDRKVWILCNDCNDTTEVYFHIIGQKCSHCRSYNTRTISPPTTP 181 + +DEEIE+T+MPEDYR++KVWILCNDCNDTTEVYFHIIGQKCSHC+SYNTRTI PP P Sbjct: 48 KSLDEEIEATVMPEDYRNKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIQPPVLP 107 Query: 182 Q 184 Q Sbjct: 108 Q 108 >ref|NP_001239836.1| uncharacterized protein LOC100812839 [Glycine max] gi|255636475|gb|ACU18576.1| unknown [Glycine max] Length = 267 Score = 120 bits (302), Expect = 9e-26 Identities = 49/61 (80%), Positives = 57/61 (93%) Frame = +2 Query: 2 REIDEEIESTIMPEDYRDRKVWILCNDCNDTTEVYFHIIGQKCSHCRSYNTRTISPPTTP 181 + IDEEIE+T+MP+DYR+RKVWILCNDCNDTTEVYFHI+GQKC HCRSYNTRT++PP P Sbjct: 207 KRIDEEIEATVMPQDYRNRKVWILCNDCNDTTEVYFHILGQKCGHCRSYNTRTVAPPVLP 266 Query: 182 Q 184 Q Sbjct: 267 Q 267 >ref|XP_002516875.1| zinc finger protein, putative [Ricinus communis] gi|223543963|gb|EEF45489.1| zinc finger protein, putative [Ricinus communis] Length = 269 Score = 120 bits (302), Expect = 9e-26 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = +2 Query: 2 REIDEEIESTIMPEDYRDRKVWILCNDCNDTTEVYFHIIGQKCSHCRSYNTRTISPPTTP 181 + IDEEIE+T+MPEDYR +KVWILCNDCNDTTEVYFHIIGQKCSHC+SYNTRTI+PP P Sbjct: 209 KRIDEEIEATVMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLP 268 Query: 182 Q 184 Q Sbjct: 269 Q 269 >ref|NP_001241502.1| uncharacterized protein LOC100792038 [Glycine max] gi|255646865|gb|ACU23903.1| unknown [Glycine max] Length = 267 Score = 120 bits (300), Expect = 1e-25 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = +2 Query: 2 REIDEEIESTIMPEDYRDRKVWILCNDCNDTTEVYFHIIGQKCSHCRSYNTRTISPPTTP 181 + IDEEIE+T+MPEDYR+RKVWILCNDCNDTTEVYFHI+GQKC HCRSYNTR ++PP P Sbjct: 207 KRIDEEIEATVMPEDYRNRKVWILCNDCNDTTEVYFHILGQKCGHCRSYNTRAVAPPVLP 266 Query: 182 Q 184 Q Sbjct: 267 Q 267 >ref|XP_002312758.1| predicted protein [Populus trichocarpa] gi|222852578|gb|EEE90125.1| predicted protein [Populus trichocarpa] Length = 269 Score = 119 bits (299), Expect = 2e-25 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 8 IDEEIESTIMPEDYRDRKVWILCNDCNDTTEVYFHIIGQKCSHCRSYNTRTISPPTTPQ 184 IDEEIE+T+MPEDY RKVWILCNDCNDTTEVYFHIIGQKCSHC+SYNTRTI+PP PQ Sbjct: 211 IDEEIEATVMPEDYSHRKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLPQ 269