BLASTX nr result
ID: Dioscorea21_contig00020593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020593 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus c... 96 3e-18 ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucum... 92 4e-17 ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucum... 92 4e-17 emb|CBI22389.3| unnamed protein product [Vitis vinifera] 92 4e-17 ref|XP_002265238.1| PREDICTED: tyrosyl-tRNA synthetase-like [Vit... 92 4e-17 >ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis] gi|223547802|gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis] Length = 492 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = -1 Query: 168 NVIEVLEERGLLDAITSENLRSVASTSNLKVYCGFDPTAESLHLGNLLAIIVLSWF 1 NV+++LEERGLL+++TS+NLRS S S LKVYCGFDPTAESLHLGNL+ IIVLSWF Sbjct: 66 NVVDILEERGLLESVTSDNLRSACSISTLKVYCGFDPTAESLHLGNLIGIIVLSWF 121 >ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus] Length = 493 Score = 92.0 bits (227), Expect = 4e-17 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = -1 Query: 168 NVIEVLEERGLLDAITSENLRSVASTSNLKVYCGFDPTAESLHLGNLLAIIVLSWF 1 NVI++LE+RGLLD+ITS+NLRS AS S LKVYCGFDPTA+SLHLGNLL +IVLSWF Sbjct: 67 NVIQILEQRGLLDSITSDNLRS-ASLSPLKVYCGFDPTAQSLHLGNLLGLIVLSWF 121 >ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus] Length = 493 Score = 92.0 bits (227), Expect = 4e-17 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = -1 Query: 168 NVIEVLEERGLLDAITSENLRSVASTSNLKVYCGFDPTAESLHLGNLLAIIVLSWF 1 NVI++LE+RGLLD+ITS+NLRS AS S LKVYCGFDPTA+SLHLGNLL +IVLSWF Sbjct: 67 NVIQILEQRGLLDSITSDNLRS-ASLSPLKVYCGFDPTAQSLHLGNLLGLIVLSWF 121 >emb|CBI22389.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = -1 Query: 171 ANVIEVLEERGLLDAITSENLRSVASTSNLKVYCGFDPTAESLHLGNLLAIIVLSWF 1 +NVIE+LE+RGL+D+ITS LR+ +ST LKVYCGFDPTAESLHLGNLL +IVLSWF Sbjct: 59 SNVIEILEQRGLVDSITSPILRASSSTQTLKVYCGFDPTAESLHLGNLLGLIVLSWF 115 >ref|XP_002265238.1| PREDICTED: tyrosyl-tRNA synthetase-like [Vitis vinifera] Length = 483 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = -1 Query: 171 ANVIEVLEERGLLDAITSENLRSVASTSNLKVYCGFDPTAESLHLGNLLAIIVLSWF 1 +NVIE+LE+RGL+D+ITS LR+ +ST LKVYCGFDPTAESLHLGNLL +IVLSWF Sbjct: 57 SNVIEILEQRGLVDSITSPILRASSSTQTLKVYCGFDPTAESLHLGNLLGLIVLSWF 113