BLASTX nr result
ID: Dioscorea21_contig00020566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020566 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579845.1| PREDICTED: two-component response regulator ... 72 6e-11 gb|ACG45341.1| RR1 - Corn type-A response regulator [Zea mays] 70 1e-10 ref|NP_001137062.1| uncharacterized protein LOC100217235 [Zea ma... 70 1e-10 ref|XP_002447894.1| hypothetical protein SORBIDRAFT_06g017560 [S... 70 2e-10 ref|XP_002446528.1| hypothetical protein SORBIDRAFT_06g017550 [S... 70 2e-10 >ref|XP_003579845.1| PREDICTED: two-component response regulator ARR9-like [Brachypodium distachyon] Length = 224 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/68 (54%), Positives = 48/68 (70%), Gaps = 2/68 (2%) Frame = +2 Query: 317 DDSPLDRRIVEMML--NRCGGFFEVIAVESGVKAIEVLGLNEGKADCPIVNVQKIDIILT 490 DDSP+DR++VE++L + C G F VIAV+S KA+E LGL +GK Q ID++LT Sbjct: 16 DDSPVDRKVVELVLGSSACAGSFHVIAVDSAKKAMEFLGLKDGKEQ------QDIDMVLT 69 Query: 491 DYCMPGMT 514 DYCMP MT Sbjct: 70 DYCMPEMT 77 >gb|ACG45341.1| RR1 - Corn type-A response regulator [Zea mays] Length = 238 Score = 70.5 bits (171), Expect = 1e-10 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +2 Query: 317 DDSPLDRRIVEMML--NRCGGFFEVIAVESGVKAIEVLGLNEGKADCPIVNVQKIDIILT 490 DDSP+DRR+ +++L N C G F VIAV+S KA+E LGL +G + Q ID++LT Sbjct: 18 DDSPVDRRVAQLLLSSNSCAGSFHVIAVDSAKKAMEFLGLKDGGKE------QAIDMVLT 71 Query: 491 DYCMPGMT 514 DYCMP MT Sbjct: 72 DYCMPEMT 79 >ref|NP_001137062.1| uncharacterized protein LOC100217235 [Zea mays] gi|194698206|gb|ACF83187.1| unknown [Zea mays] gi|224029529|gb|ACN33840.1| unknown [Zea mays] gi|414587101|tpg|DAA37672.1| TPA: RR1-Corn type-A response regulator [Zea mays] Length = 244 Score = 70.5 bits (171), Expect = 1e-10 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +2 Query: 317 DDSPLDRRIVEMML--NRCGGFFEVIAVESGVKAIEVLGLNEGKADCPIVNVQKIDIILT 490 DDSP+DRR+ +++L N C G F VIAV+S KA+E LGL +G + Q ID++LT Sbjct: 18 DDSPVDRRVAQLLLSSNSCAGSFHVIAVDSAKKAMEFLGLKDGGKE------QAIDMVLT 71 Query: 491 DYCMPGMT 514 DYCMP MT Sbjct: 72 DYCMPEMT 79 >ref|XP_002447894.1| hypothetical protein SORBIDRAFT_06g017560 [Sorghum bicolor] gi|241939077|gb|EES12222.1| hypothetical protein SORBIDRAFT_06g017560 [Sorghum bicolor] Length = 194 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/68 (52%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = +2 Query: 317 DDSPLDRRIVEMML--NRCGGFFEVIAVESGVKAIEVLGLNEGKADCPIVNVQKIDIILT 490 DDSP+DRR+ +++L N C G F VIAV+S KA+E LGL +G Q ID++LT Sbjct: 20 DDSPVDRRVAQLLLSSNSCAGSFHVIAVDSAKKAMEFLGLKDGGG-----KEQTIDMVLT 74 Query: 491 DYCMPGMT 514 DYCMP MT Sbjct: 75 DYCMPEMT 82 >ref|XP_002446528.1| hypothetical protein SORBIDRAFT_06g017550 [Sorghum bicolor] gi|241937711|gb|EES10856.1| hypothetical protein SORBIDRAFT_06g017550 [Sorghum bicolor] Length = 249 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/68 (52%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = +2 Query: 317 DDSPLDRRIVEMML--NRCGGFFEVIAVESGVKAIEVLGLNEGKADCPIVNVQKIDIILT 490 DDSP+DRR+ +++L N C G F VIAV+S KA+E LGL +G Q ID++LT Sbjct: 20 DDSPVDRRVAQLLLSSNSCAGSFHVIAVDSAKKAMEFLGLKDGGG-----KEQAIDMVLT 74 Query: 491 DYCMPGMT 514 DYCMP MT Sbjct: 75 DYCMPEMT 82