BLASTX nr result
ID: Dioscorea21_contig00019819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019819 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531283.1| ring finger protein, putative [Ricinus commu... 57 1e-06 ref|XP_002311661.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002531283.1| ring finger protein, putative [Ricinus communis] gi|223529116|gb|EEF31096.1| ring finger protein, putative [Ricinus communis] Length = 445 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -1 Query: 368 LCCGQQLNSTLALTDLMDIWPPTASSHRVQTHVGASAKDFVIFLSYRRKVLSS 210 +C GQ + TL L +L+D+W TASS +V VG+SAKDFV+ LSY RKV +S Sbjct: 393 MCRGQSVLPTLQLHNLVDLWFRTASSKKVPASVGSSAKDFVMVLSYNRKVQAS 445 >ref|XP_002311661.1| predicted protein [Populus trichocarpa] gi|222851481|gb|EEE89028.1| predicted protein [Populus trichocarpa] Length = 415 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -1 Query: 368 LCCGQQLNSTLALTDLMDIWPPTAS-SHRVQTHVGASAKDFVIFLSYRRKV 219 L GQ + STL L +L+D W TAS S R+QT VG+SAKDFV+ LSY RKV Sbjct: 348 LLLGQPVASTLQLHNLVDWWSQTASASERIQTTVGSSAKDFVMVLSYGRKV 398