BLASTX nr result
ID: Dioscorea21_contig00019416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019416 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEG74553.1| hypothetical protein [Phoenix dactylifera] 77 2e-12 gb|AFK40462.1| unknown [Medicago truncatula] 66 3e-09 ref|XP_003609366.1| Blue copper protein [Medicago truncatula] gi... 66 3e-09 ref|XP_002527190.1| Blue copper protein precursor, putative [Ric... 64 2e-08 gb|ACL51764.1| putative phytocyanin [Pinus peuce] 64 2e-08 >gb|AEG74553.1| hypothetical protein [Phoenix dactylifera] Length = 188 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -3 Query: 147 AATKHTVGGTTGWSIPPNANATFYSDWAASQTFVVGDTLVFTFQTGTH 4 AA H VGG+TGW IPPN++ FYSDWA++QTF VGDTLVF FQTG+H Sbjct: 30 AAATHVVGGSTGWIIPPNSS--FYSDWASTQTFAVGDTLVFNFQTGSH 75 >gb|AFK40462.1| unknown [Medicago truncatula] Length = 229 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = -3 Query: 147 AATKHTVGGTTGWSIPPNANATFYSDWAASQTFVVGDTLVFTFQTGTHN 1 A T+H VG TTGW+IP N A+FY++WA+++TF VGDTLVF + +G H+ Sbjct: 25 AQTRHVVGDTTGWTIPTNG-ASFYTNWASNKTFTVGDTLVFNYASGQHD 72 >ref|XP_003609366.1| Blue copper protein [Medicago truncatula] gi|355510421|gb|AES91563.1| Blue copper protein [Medicago truncatula] Length = 370 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = -3 Query: 147 AATKHTVGGTTGWSIPPNANATFYSDWAASQTFVVGDTLVFTFQTGTHN 1 A T+H VG TTGW+IP N A+FY++WA+++TF VGDTLVF + +G H+ Sbjct: 25 AQTRHVVGDTTGWTIPTNG-ASFYTNWASNKTFTVGDTLVFNYASGQHD 72 >ref|XP_002527190.1| Blue copper protein precursor, putative [Ricinus communis] gi|223533455|gb|EEF35203.1| Blue copper protein precursor, putative [Ricinus communis] Length = 164 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = -3 Query: 147 AATKHTVGGTTGWSIPPNANATFYSDWAASQTFVVGDTLVFTFQTGTH 4 AATK+TVG + GW++PP+ + FY DWA ++TF +GD+LVF + TGTH Sbjct: 25 AATKYTVGDSLGWTVPPSNSVGFYEDWANNRTFQIGDSLVFNW-TGTH 71 >gb|ACL51764.1| putative phytocyanin [Pinus peuce] Length = 89 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = -3 Query: 147 AATKHTVGGTTGWSIPPNANATFYSDWAASQTFVVGDTLVFTFQTGTHN 1 AAT +TVGG+TGW+IP +N YSDW S TF +GD LVF F T HN Sbjct: 25 AATTYTVGGSTGWTIP-TSNTKLYSDWVKSTTFKLGDVLVFKFTTNVHN 72