BLASTX nr result
ID: Dioscorea21_contig00019342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019342 (1096 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFS65102.1| CCR4-associated factor 1-related protein [Elaeis ... 86 2e-14 ref|XP_002877329.1| hypothetical protein ARALYDRAFT_484842 [Arab... 82 2e-13 ref|NP_190012.1| putative CCR4-associated factor 1-9 [Arabidopsi... 82 2e-13 ref|XP_002328114.1| predicted protein [Populus trichocarpa] gi|2... 81 5e-13 ref|NP_197617.1| putative CCR4-associated factor 1-11 [Arabidops... 80 7e-13 >gb|AFS65102.1| CCR4-associated factor 1-related protein [Elaeis guineensis] Length = 276 Score = 85.5 bits (210), Expect = 2e-14 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -1 Query: 1096 GGLERVAREMGVERVAGRSHQAGSDSLLTWHAYARMKERFFGDDSEGEEHAGVLYGLEVF 917 GGL+RVA + V+R AGR HQAGSDSLLTWHA+ RMKE +F + + E HAGVLYGLEVF Sbjct: 218 GGLDRVASTLQVDRAAGRCHQAGSDSLLTWHAFRRMKELYFAKEDD-ERHAGVLYGLEVF 276 >ref|XP_002877329.1| hypothetical protein ARALYDRAFT_484842 [Arabidopsis lyrata subsp. lyrata] gi|297323167|gb|EFH53588.1| hypothetical protein ARALYDRAFT_484842 [Arabidopsis lyrata subsp. lyrata] Length = 280 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -1 Query: 1096 GGLERVAREMGVERVAGRSHQAGSDSLLTWHAYARMKERFFGDDSEGEEHAGVLYGLEVF 917 GGL+RVAR + V R G+ HQAGSDSLLTWHA+ RM++ +F D E+HAGVLYGLEVF Sbjct: 222 GGLDRVARTLEVNRAVGKCHQAGSDSLLTWHAFQRMRDLYFVQDGP-EKHAGVLYGLEVF 280 >ref|NP_190012.1| putative CCR4-associated factor 1-9 [Arabidopsis thaliana] gi|75335618|sp|Q9LXM2.1|CAF1I_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 9 gi|7649377|emb|CAB88994.1| CCR4-associated factor 1-like protein [Arabidopsis thaliana] gi|15292829|gb|AAK92783.1| putative CCR4-associated factor 1 [Arabidopsis thaliana] gi|21436313|gb|AAM51295.1| putative CCR4-associated factor 1 [Arabidopsis thaliana] gi|332644361|gb|AEE77882.1| putative CCR4-associated factor 1-9 [Arabidopsis thaliana] Length = 280 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -1 Query: 1096 GGLERVAREMGVERVAGRSHQAGSDSLLTWHAYARMKERFFGDDSEGEEHAGVLYGLEVF 917 GGL+RVAR + V R G+ HQAGSDSLLTWHA+ RM++ +F D E+HAGVLYGLEVF Sbjct: 222 GGLDRVARTLEVNRAVGKCHQAGSDSLLTWHAFQRMRDLYFVQDGP-EKHAGVLYGLEVF 280 >ref|XP_002328114.1| predicted protein [Populus trichocarpa] gi|222837629|gb|EEE75994.1| predicted protein [Populus trichocarpa] Length = 277 Score = 80.9 bits (198), Expect = 5e-13 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -1 Query: 1096 GGLERVAREMGVERVAGRSHQAGSDSLLTWHAYARMKERFFGDDSEGEEHAGVLYGLEVF 917 GGL+RVAR + V R G+ HQAGSDSLLTWHA+ +M++ FF D E+HAGVLYGLEVF Sbjct: 218 GGLDRVARTLEVNREVGKCHQAGSDSLLTWHAFQKMRDVFFVKDGP-EQHAGVLYGLEVF 276 >ref|NP_197617.1| putative CCR4-associated factor 1-11 [Arabidopsis thaliana] gi|75334084|sp|Q9FMS6.1|CAF1K_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 11 gi|9757805|dbj|BAB08323.1| CCR4-associated factor-like protein [Arabidopsis thaliana] gi|17381058|gb|AAL36341.1| putative CCR4-associated factor [Arabidopsis thaliana] gi|25054979|gb|AAN71961.1| putative CCR4-associated factor [Arabidopsis thaliana] gi|332005618|gb|AED93001.1| putative CCR4-associated factor 1-11 [Arabidopsis thaliana] Length = 278 Score = 80.5 bits (197), Expect = 7e-13 Identities = 38/60 (63%), Positives = 47/60 (78%) Frame = -1 Query: 1096 GGLERVAREMGVERVAGRSHQAGSDSLLTWHAYARMKERFFGDDSEGEEHAGVLYGLEVF 917 GGL+RVAR + V R G+ HQAGSDSLLTW A+ RM++ +F +D E+HAGVLYGLEVF Sbjct: 220 GGLDRVARSLEVNRAVGKCHQAGSDSLLTWQAFQRMRDLYFVEDG-AEKHAGVLYGLEVF 278