BLASTX nr result
ID: Dioscorea21_contig00019229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019229 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ93818.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 3e-06 ref|XP_002445103.1| hypothetical protein SORBIDRAFT_07g004120 [S... 56 3e-06 ref|NP_001130336.1| uncharacterized protein LOC100191431 [Zea ma... 55 8e-06 >dbj|BAJ93818.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 347 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +3 Query: 297 MVTGCSVSDLAAKLAFFPPSPATYSVKK--VNGRLVASG 407 M++GCSVS LAA+ AFFPP PATY+V+K +GRLVASG Sbjct: 1 MLSGCSVSSLAARFAFFPPDPATYAVRKDEASGRLVASG 39 >ref|XP_002445103.1| hypothetical protein SORBIDRAFT_07g004120 [Sorghum bicolor] gi|241941453|gb|EES14598.1| hypothetical protein SORBIDRAFT_07g004120 [Sorghum bicolor] Length = 366 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +3 Query: 297 MVTGCSVSDLAAKLAFFPPSPATYSVKK--VNGRLVASG 407 M++GCSVS LAA+ AFFPP PATY+V+K GRLVASG Sbjct: 1 MLSGCSVSSLAARFAFFPPEPATYAVRKDEATGRLVASG 39 >ref|NP_001130336.1| uncharacterized protein LOC100191431 [Zea mays] gi|194688878|gb|ACF78523.1| unknown [Zea mays] gi|195633835|gb|ACG36762.1| esterase/lipase/thioesterase [Zea mays] gi|413917323|gb|AFW57255.1| esterase/lipase/thioesterase isoform 1 [Zea mays] gi|413917324|gb|AFW57256.1| esterase/lipase/thioesterase isoform 2 [Zea mays] gi|413917325|gb|AFW57257.1| esterase/lipase/thioesterase isoform 3 [Zea mays] Length = 370 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +3 Query: 297 MVTGCSVSDLAAKLAFFPPSPATYSVKK--VNGRLVASG 407 M +GCSVS LAA+ AFFPP PATY+V+K GRLVASG Sbjct: 1 MPSGCSVSSLAARFAFFPPEPATYAVRKDEATGRLVASG 39