BLASTX nr result
ID: Dioscorea21_contig00019207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019207 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEC46976.1| somatic embryogenesis receptor-like kinase [Anana... 94 2e-17 gb|ACZ56417.1| somatic embryogenesis receptor-like kinase 1 [Pin... 94 2e-17 gb|ACY91853.1| somatic embryogenesis receptor-like kinase 1 [Ara... 94 2e-17 gb|AEC46975.1| somatic embryogenesis receptor-like kinase [Anana... 93 2e-17 ref|XP_002270847.1| PREDICTED: somatic embryogenesis receptor ki... 93 3e-17 >gb|AEC46976.1| somatic embryogenesis receptor-like kinase [Ananas comosus] gi|374433970|gb|AEZ52377.1| somatic embryogenesis receptor-like kinase 2 [Ananas comosus] Length = 624 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/63 (69%), Positives = 53/63 (84%) Frame = -1 Query: 196 LLKEKTLDNIVDPKLKNNYVKEEVESLIQIALLCTQDEPDHRPKMSEVVRMIQGNGPAER 17 LLKEK L+ +VDP L+NNY++ EVESLIQ+ALLCTQ P RPKMSEVVRM++G+G AER Sbjct: 523 LLKEKKLEMLVDPDLQNNYIESEVESLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAER 582 Query: 16 WVE 8 W E Sbjct: 583 WEE 585 >gb|ACZ56417.1| somatic embryogenesis receptor-like kinase 1 [Pinus massoniana] Length = 626 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/63 (71%), Positives = 52/63 (82%) Frame = -1 Query: 196 LLKEKTLDNIVDPKLKNNYVKEEVESLIQIALLCTQDEPDHRPKMSEVVRMIQGNGPAER 17 LLKE+ LD +VDP LKNNYV+ EVE LIQ+ALLCTQ P RPKMSEVVRM++G+G AER Sbjct: 525 LLKERRLDMLVDPDLKNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAER 584 Query: 16 WVE 8 W E Sbjct: 585 WEE 587 >gb|ACY91853.1| somatic embryogenesis receptor-like kinase 1 [Araucaria angustifolia] Length = 630 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/63 (71%), Positives = 52/63 (82%) Frame = -1 Query: 196 LLKEKTLDNIVDPKLKNNYVKEEVESLIQIALLCTQDEPDHRPKMSEVVRMIQGNGPAER 17 LLKE+ LD +VDP LKNNYV+ EVE LIQ+ALLCTQ P RPKMSEVVRM++G+G AER Sbjct: 529 LLKERRLDMLVDPDLKNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAER 588 Query: 16 WVE 8 W E Sbjct: 589 WEE 591 >gb|AEC46975.1| somatic embryogenesis receptor-like kinase [Ananas comosus] gi|375335090|gb|AFA53652.1| somatic embryogenesis receptor-like kinase 1 [Ananas comosus] Length = 629 Score = 93.2 bits (230), Expect = 2e-17 Identities = 45/63 (71%), Positives = 53/63 (84%) Frame = -1 Query: 196 LLKEKTLDNIVDPKLKNNYVKEEVESLIQIALLCTQDEPDHRPKMSEVVRMIQGNGPAER 17 LLKEK L+ +VDP L+NNYV+ EVESLIQ+ALLCTQ P RPKMSEVVRM++G+G AER Sbjct: 529 LLKEKRLEMLVDPDLQNNYVEAEVESLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAER 588 Query: 16 WVE 8 W E Sbjct: 589 WEE 591 >ref|XP_002270847.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Vitis vinifera] gi|296088044|emb|CBI35327.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 92.8 bits (229), Expect = 3e-17 Identities = 45/63 (71%), Positives = 52/63 (82%) Frame = -1 Query: 196 LLKEKTLDNIVDPKLKNNYVKEEVESLIQIALLCTQDEPDHRPKMSEVVRMIQGNGPAER 17 LLKEK L+ +VDP LKNNYV+ EVE LIQ+ALLCTQ P RPKMSEVVRM++G+G AER Sbjct: 524 LLKEKKLEMLVDPDLKNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAER 583 Query: 16 WVE 8 W E Sbjct: 584 WDE 586