BLASTX nr result
ID: Dioscorea21_contig00018218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00018218 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ27757.1| receptor-like protein [Malus x domestica] 55 5e-06 gb|AEQ27745.1| receptor-like protein [Malus x domestica] 55 5e-06 gb|AEQ27744.1| receptor-like protein [Malus x domestica] 55 5e-06 gb|AEQ27743.1| receptor-like protein [Malus x domestica] 55 5e-06 >gb|AEQ27757.1| receptor-like protein [Malus x domestica] Length = 978 Score = 55.5 bits (132), Expect = 5e-06 Identities = 36/88 (40%), Positives = 45/88 (51%) Frame = -1 Query: 272 SSLQILDLAHNGLSGCIPSTFGDFKAMVVTNHKELLSLLSIPPTTMRGCTFHESCTGTHT 93 +SLQILDLAHN LSG IP F D AM + S PT G + H Sbjct: 719 TSLQILDLAHNKLSGMIPRCFHDLSAMADFSE-------SFSPTRGFGTSAH-------- 763 Query: 92 YTTFPYSDSLSIIAKGLQMEYSKLLSLV 9 F SD+ ++ KG++MEYSK+L V Sbjct: 764 --MFELSDNAILVKKGIEMEYSKILGFV 789 >gb|AEQ27745.1| receptor-like protein [Malus x domestica] Length = 978 Score = 55.5 bits (132), Expect = 5e-06 Identities = 36/88 (40%), Positives = 45/88 (51%) Frame = -1 Query: 272 SSLQILDLAHNGLSGCIPSTFGDFKAMVVTNHKELLSLLSIPPTTMRGCTFHESCTGTHT 93 +SLQILDLAHN LSG IP F D AM + S PT G + H Sbjct: 719 TSLQILDLAHNKLSGMIPRCFHDLSAMADFSE-------SFSPTRGFGTSAH-------- 763 Query: 92 YTTFPYSDSLSIIAKGLQMEYSKLLSLV 9 F SD+ ++ KG++MEYSK+L V Sbjct: 764 --MFELSDNAILVKKGIEMEYSKILGFV 789 >gb|AEQ27744.1| receptor-like protein [Malus x domestica] Length = 976 Score = 55.5 bits (132), Expect = 5e-06 Identities = 36/88 (40%), Positives = 45/88 (51%) Frame = -1 Query: 272 SSLQILDLAHNGLSGCIPSTFGDFKAMVVTNHKELLSLLSIPPTTMRGCTFHESCTGTHT 93 +SLQILDLAHN LSG IP F D AM + S PT G + H Sbjct: 717 TSLQILDLAHNKLSGMIPRCFHDLSAMADFSE-------SFSPTRGFGTSAH-------- 761 Query: 92 YTTFPYSDSLSIIAKGLQMEYSKLLSLV 9 F SD+ ++ KG++MEYSK+L V Sbjct: 762 --MFELSDNAILVKKGIEMEYSKILGFV 787 >gb|AEQ27743.1| receptor-like protein [Malus x domestica] Length = 978 Score = 55.5 bits (132), Expect = 5e-06 Identities = 36/88 (40%), Positives = 45/88 (51%) Frame = -1 Query: 272 SSLQILDLAHNGLSGCIPSTFGDFKAMVVTNHKELLSLLSIPPTTMRGCTFHESCTGTHT 93 +SLQILDLAHN LSG IP F D AM + S PT G + H Sbjct: 719 TSLQILDLAHNKLSGMIPRCFHDLSAMADFSE-------SFSPTRGFGTSAH-------- 763 Query: 92 YTTFPYSDSLSIIAKGLQMEYSKLLSLV 9 F SD+ ++ KG++MEYSK+L V Sbjct: 764 --MFELSDNAILVKKGIEMEYSKILGFV 789