BLASTX nr result
ID: Dioscorea21_contig00018090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00018090 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528311.1| clathrin heavy chain, putative [Ricinus comm... 151 6e-35 ref|XP_002316201.1| predicted protein [Populus trichocarpa] gi|2... 149 2e-34 gb|AAG50828.1|AC074395_2 clathrin heavy chain, putative [Arabido... 149 2e-34 gb|AAG51341.1|AC012562_2 putative clathrin heavy chain, 3' parti... 149 2e-34 ref|NP_187466.4| Clathrin, heavy chain [Arabidopsis thaliana] gi... 149 2e-34 >ref|XP_002528311.1| clathrin heavy chain, putative [Ricinus communis] gi|223532266|gb|EEF34069.1| clathrin heavy chain, putative [Ricinus communis] Length = 1705 Score = 151 bits (381), Expect = 6e-35 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = +3 Query: 3 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 182 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA Sbjct: 1036 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 1095 Query: 183 VNVLLDNIRSIDRAVEF 233 VNVLLDNIRSIDRAVEF Sbjct: 1096 VNVLLDNIRSIDRAVEF 1112 >ref|XP_002316201.1| predicted protein [Populus trichocarpa] gi|222865241|gb|EEF02372.1| predicted protein [Populus trichocarpa] Length = 1705 Score = 149 bits (377), Expect = 2e-34 Identities = 76/77 (98%), Positives = 77/77 (100%) Frame = +3 Query: 3 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 182 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA Sbjct: 1036 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 1095 Query: 183 VNVLLDNIRSIDRAVEF 233 VNVLLDNI+SIDRAVEF Sbjct: 1096 VNVLLDNIQSIDRAVEF 1112 >gb|AAG50828.1|AC074395_2 clathrin heavy chain, putative [Arabidopsis thaliana] Length = 1516 Score = 149 bits (376), Expect = 2e-34 Identities = 75/77 (97%), Positives = 77/77 (100%) Frame = +3 Query: 3 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 182 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA Sbjct: 849 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 908 Query: 183 VNVLLDNIRSIDRAVEF 233 VNVLLDN+RSI+RAVEF Sbjct: 909 VNVLLDNVRSIERAVEF 925 >gb|AAG51341.1|AC012562_2 putative clathrin heavy chain, 3' partial; 6334-1 [Arabidopsis thaliana] Length = 1280 Score = 149 bits (376), Expect = 2e-34 Identities = 75/77 (97%), Positives = 77/77 (100%) Frame = +3 Query: 3 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 182 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA Sbjct: 1036 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 1095 Query: 183 VNVLLDNIRSIDRAVEF 233 VNVLLDN+RSI+RAVEF Sbjct: 1096 VNVLLDNVRSIERAVEF 1112 >ref|NP_187466.4| Clathrin, heavy chain [Arabidopsis thaliana] gi|122223626|sp|Q0WLB5.1|CLAH2_ARATH RecName: Full=Clathrin heavy chain 2 gi|110740394|dbj|BAF02092.1| hypothetical protein [Arabidopsis thaliana] gi|332641123|gb|AEE74644.1| Clathrin, heavy chain [Arabidopsis thaliana] Length = 1703 Score = 149 bits (376), Expect = 2e-34 Identities = 75/77 (97%), Positives = 77/77 (100%) Frame = +3 Query: 3 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 182 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA Sbjct: 1036 FNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQA 1095 Query: 183 VNVLLDNIRSIDRAVEF 233 VNVLLDN+RSI+RAVEF Sbjct: 1096 VNVLLDNVRSIERAVEF 1112