BLASTX nr result
ID: Dioscorea21_contig00017854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017854 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW82923.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 91 1e-16 gb|AFW82922.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 91 1e-16 gb|AFW82921.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 91 1e-16 ref|NP_001152705.1| LOC100286346 [Zea mays] gi|195611888|gb|ACG2... 91 1e-16 emb|CBI19296.3| unnamed protein product [Vitis vinifera] 90 2e-16 >gb|AFW82923.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 74 Score = 90.9 bits (224), Expect = 1e-16 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 175 MTTFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 312 M TFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 46 >gb|AFW82922.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 78 Score = 90.9 bits (224), Expect = 1e-16 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 175 MTTFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 312 M TFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 46 >gb|AFW82921.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 62 Score = 90.9 bits (224), Expect = 1e-16 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 175 MTTFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 312 M TFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 46 >ref|NP_001152705.1| LOC100286346 [Zea mays] gi|195611888|gb|ACG27774.1| transcription initiation factor IIA gamma chain [Zea mays] gi|195659197|gb|ACG49066.1| transcription initiation factor IIA gamma chain [Zea mays] gi|219887343|gb|ACL54046.1| unknown [Zea mays] gi|413950271|gb|AFW82920.1| transcription initiation factor IIA gamma chain [Zea mays] Length = 106 Score = 90.9 bits (224), Expect = 1e-16 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 175 MTTFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 312 M TFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMT 46 >emb|CBI19296.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 90.1 bits (222), Expect = 2e-16 Identities = 48/64 (75%), Positives = 50/64 (78%) Frame = +1 Query: 121 RVFYLSIVISAGLFLSVVMTTFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFD 300 R F L + + V M TFELYRRSTIGMCLTETLDEMV NGTLSPELAIQVLVQFD Sbjct: 40 RQFCLCFLSLPSPSIIVRMATFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFD 99 Query: 301 KSMT 312 KSMT Sbjct: 100 KSMT 103