BLASTX nr result
ID: Dioscorea21_contig00017770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017770 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABU40775.1| NAC-like protein 3 [Crocus sativus] 133 2e-29 gb|ABU40776.1| NAC-like protein 7 [Crocus sativus] 133 2e-29 gb|ACM90162.1| NAC domain protein [Citrus trifoliata] 129 2e-28 ref|XP_002525465.1| NAC domain-containing protein 21/22, putativ... 129 3e-28 gb|ADG58000.1| transcription factor [Lycoris longituba] 128 4e-28 >gb|ABU40775.1| NAC-like protein 3 [Crocus sativus] Length = 318 Score = 133 bits (334), Expect = 2e-29 Identities = 55/67 (82%), Positives = 64/67 (95%) Frame = +3 Query: 18 ESLDMPPGFRFHPTDEEIISHYLTPKVLNHGFTARAIGQVDVNKCEPWDLPSKAKMGEKE 197 + LD+PPGFRFHPTDEEII+HYL+PK++N FTARA+G+VD+NKCEPWDLPSKAKMGEKE Sbjct: 3 DCLDLPPGFRFHPTDEEIITHYLSPKMVNRSFTARAVGEVDLNKCEPWDLPSKAKMGEKE 62 Query: 198 WYFFCQR 218 WYFFCQR Sbjct: 63 WYFFCQR 69 >gb|ABU40776.1| NAC-like protein 7 [Crocus sativus] Length = 318 Score = 133 bits (334), Expect = 2e-29 Identities = 55/67 (82%), Positives = 64/67 (95%) Frame = +3 Query: 18 ESLDMPPGFRFHPTDEEIISHYLTPKVLNHGFTARAIGQVDVNKCEPWDLPSKAKMGEKE 197 + LD+PPGFRFHPTDEEII+HYL+PK++N FTARA+G+VD+NKCEPWDLPSKAKMGEKE Sbjct: 3 DCLDLPPGFRFHPTDEEIITHYLSPKMVNRSFTARAVGEVDLNKCEPWDLPSKAKMGEKE 62 Query: 198 WYFFCQR 218 WYFFCQR Sbjct: 63 WYFFCQR 69 >gb|ACM90162.1| NAC domain protein [Citrus trifoliata] Length = 348 Score = 129 bits (325), Expect = 2e-28 Identities = 54/70 (77%), Positives = 64/70 (91%) Frame = +3 Query: 9 DDQESLDMPPGFRFHPTDEEIISHYLTPKVLNHGFTARAIGQVDVNKCEPWDLPSKAKMG 188 DDQE +++PPGFRFHPTDEE+I+HYLTPKV + F+ARAIG+VD+NKCEPWDLP +AKMG Sbjct: 5 DDQEQIELPPGFRFHPTDEELITHYLTPKVFDGCFSARAIGEVDLNKCEPWDLPRRAKMG 64 Query: 189 EKEWYFFCQR 218 EKEWYFFC R Sbjct: 65 EKEWYFFCVR 74 >ref|XP_002525465.1| NAC domain-containing protein 21/22, putative [Ricinus communis] gi|223535278|gb|EEF36955.1| NAC domain-containing protein 21/22, putative [Ricinus communis] Length = 382 Score = 129 bits (323), Expect = 3e-28 Identities = 54/68 (79%), Positives = 63/68 (92%) Frame = +3 Query: 15 QESLDMPPGFRFHPTDEEIISHYLTPKVLNHGFTARAIGQVDVNKCEPWDLPSKAKMGEK 194 ++ +D+PPGFRFHPTDEEII+HYLT KV+N GF+A AIG+VD+NKCEPWDLP KAKMGEK Sbjct: 11 EDLIDLPPGFRFHPTDEEIITHYLTEKVMNSGFSACAIGEVDLNKCEPWDLPKKAKMGEK 70 Query: 195 EWYFFCQR 218 EWYFFCQR Sbjct: 71 EWYFFCQR 78 >gb|ADG58000.1| transcription factor [Lycoris longituba] Length = 77 Score = 128 bits (322), Expect = 4e-28 Identities = 55/67 (82%), Positives = 62/67 (92%) Frame = +3 Query: 18 ESLDMPPGFRFHPTDEEIISHYLTPKVLNHGFTARAIGQVDVNKCEPWDLPSKAKMGEKE 197 E +D+PPGFRFHPTDEEII+HYL+PKVLN F+A AIG+VD+NKCEPWDL SKAKMGEKE Sbjct: 3 ECIDLPPGFRFHPTDEEIITHYLSPKVLNPSFSASAIGEVDLNKCEPWDLQSKAKMGEKE 62 Query: 198 WYFFCQR 218 WYFFCQR Sbjct: 63 WYFFCQR 69