BLASTX nr result
ID: Dioscorea21_contig00017584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017584 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306203.1| predicted protein [Populus trichocarpa] gi|2... 136 2e-30 ref|XP_002334052.1| predicted protein [Populus trichocarpa] gi|2... 136 2e-30 ref|XP_002280985.2| PREDICTED: uncharacterized mscS family prote... 135 3e-30 emb|CBI37812.3| unnamed protein product [Vitis vinifera] 135 3e-30 ref|XP_002521235.1| protein kinase, putative [Ricinus communis] ... 135 4e-30 >ref|XP_002306203.1| predicted protein [Populus trichocarpa] gi|222849167|gb|EEE86714.1| predicted protein [Populus trichocarpa] Length = 494 Score = 136 bits (342), Expect = 2e-30 Identities = 63/69 (91%), Positives = 67/69 (97%) Frame = -2 Query: 207 ADVFSFAIVLWELLTGKIPYEYMTPLQAAVGVVQKGLRPTIPKNTNPKLAELLKRCWQQD 28 ADVFSF IVLWELLTGKIPYEY+TPLQAAVGVVQKGLRPTIPKNT PKLAELL++CWQQD Sbjct: 392 ADVFSFGIVLWELLTGKIPYEYLTPLQAAVGVVQKGLRPTIPKNTQPKLAELLEKCWQQD 451 Query: 27 PSLRPDFSE 1 P+LRPDFSE Sbjct: 452 PALRPDFSE 460 >ref|XP_002334052.1| predicted protein [Populus trichocarpa] gi|222839744|gb|EEE78067.1| predicted protein [Populus trichocarpa] Length = 370 Score = 136 bits (342), Expect = 2e-30 Identities = 63/69 (91%), Positives = 67/69 (97%) Frame = -2 Query: 207 ADVFSFAIVLWELLTGKIPYEYMTPLQAAVGVVQKGLRPTIPKNTNPKLAELLKRCWQQD 28 ADVFSF IVLWELLTGKIPYEY+TPLQAAVGVVQKGLRPTIPKNT PKLAELL++CWQQD Sbjct: 268 ADVFSFGIVLWELLTGKIPYEYLTPLQAAVGVVQKGLRPTIPKNTQPKLAELLEKCWQQD 327 Query: 27 PSLRPDFSE 1 P+LRPDFSE Sbjct: 328 PALRPDFSE 336 >ref|XP_002280985.2| PREDICTED: uncharacterized mscS family protein At1g78610-like [Vitis vinifera] Length = 1515 Score = 135 bits (341), Expect = 3e-30 Identities = 62/69 (89%), Positives = 68/69 (98%) Frame = -2 Query: 207 ADVFSFAIVLWELLTGKIPYEYMTPLQAAVGVVQKGLRPTIPKNTNPKLAELLKRCWQQD 28 ADVFSF IVLWELLTGK+PYEY+TPLQAAVGVVQKGLRPT+PKNT+PKLAELL+RCWQQD Sbjct: 502 ADVFSFGIVLWELLTGKLPYEYLTPLQAAVGVVQKGLRPTMPKNTHPKLAELLERCWQQD 561 Query: 27 PSLRPDFSE 1 P+LRPDFSE Sbjct: 562 PTLRPDFSE 570 >emb|CBI37812.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 135 bits (341), Expect = 3e-30 Identities = 62/69 (89%), Positives = 68/69 (98%) Frame = -2 Query: 207 ADVFSFAIVLWELLTGKIPYEYMTPLQAAVGVVQKGLRPTIPKNTNPKLAELLKRCWQQD 28 ADVFSF IVLWELLTGK+PYEY+TPLQAAVGVVQKGLRPT+PKNT+PKLAELL+RCWQQD Sbjct: 476 ADVFSFGIVLWELLTGKLPYEYLTPLQAAVGVVQKGLRPTMPKNTHPKLAELLERCWQQD 535 Query: 27 PSLRPDFSE 1 P+LRPDFSE Sbjct: 536 PTLRPDFSE 544 >ref|XP_002521235.1| protein kinase, putative [Ricinus communis] gi|223539503|gb|EEF41091.1| protein kinase, putative [Ricinus communis] Length = 558 Score = 135 bits (339), Expect = 4e-30 Identities = 61/69 (88%), Positives = 69/69 (100%) Frame = -2 Query: 207 ADVFSFAIVLWELLTGKIPYEYMTPLQAAVGVVQKGLRPTIPKNTNPKLAELLKRCWQQD 28 AD+FSFAIVLWELLTGK+PYEY+TPLQAAVGVVQKGLRPTIPK+T+PKLAELL++CWQQD Sbjct: 453 ADIFSFAIVLWELLTGKLPYEYLTPLQAAVGVVQKGLRPTIPKHTHPKLAELLEKCWQQD 512 Query: 27 PSLRPDFSE 1 P+LRPDFSE Sbjct: 513 PALRPDFSE 521