BLASTX nr result
ID: Dioscorea21_contig00017580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017580 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142666.1| PREDICTED: uncharacterized transporter YBR28... 77 1e-12 ref|XP_002323690.1| auxin efflux carrier component, auxin transp... 77 1e-12 ref|XP_002326270.1| predicted protein [Populus trichocarpa] gi|2... 76 2e-12 tpg|DAA57098.1| TPA: hypothetical protein ZEAMMB73_854946 [Zea m... 75 6e-12 gb|AFK32351.1| putative auxin efflux carrier-like protein PINY [... 75 6e-12 >ref|XP_004142666.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] gi|449502666|ref|XP_004161708.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 411 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = +2 Query: 323 VSGGGQSIFVTMKFAVLPIAKVFIMCFMGFLMASKYVNILSSDGRKLLN 469 V GG S+ VT+K AVLPIAKVF MCF+GFLMASKYVNIL + GRKLLN Sbjct: 12 VQAGGNSLLVTIKIAVLPIAKVFTMCFLGFLMASKYVNILPASGRKLLN 60 >ref|XP_002323690.1| auxin efflux carrier component, auxin transport protein [Populus trichocarpa] gi|222868320|gb|EEF05451.1| auxin efflux carrier component, auxin transport protein [Populus trichocarpa] Length = 414 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/61 (63%), Positives = 46/61 (75%) Frame = +2 Query: 287 RSVLEILMEGHGVSGGGQSIFVTMKFAVLPIAKVFIMCFMGFLMASKYVNILSSDGRKLL 466 R +L + G GGGQ++ T+K AVLPIAKVF MCF+GFLMASKYVNIL + GRKLL Sbjct: 3 RFLLAVDTMGANQVGGGQTLLGTIKIAVLPIAKVFTMCFLGFLMASKYVNILPASGRKLL 62 Query: 467 N 469 N Sbjct: 63 N 63 >ref|XP_002326270.1| predicted protein [Populus trichocarpa] gi|222833463|gb|EEE71940.1| predicted protein [Populus trichocarpa] Length = 412 Score = 76.3 bits (186), Expect = 2e-12 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +2 Query: 320 GVSGGGQSIFVTMKFAVLPIAKVFIMCFMGFLMASKYVNILSSDGRKLLN 469 G GGQS+ T+K AVLPIAKVF MCF+GFLMASKYVNIL + GRKLLN Sbjct: 12 GNQAGGQSLLNTIKIAVLPIAKVFTMCFLGFLMASKYVNILPASGRKLLN 61 >tpg|DAA57098.1| TPA: hypothetical protein ZEAMMB73_854946 [Zea mays] Length = 335 Score = 75.1 bits (183), Expect = 6e-12 Identities = 38/61 (62%), Positives = 45/61 (73%) Frame = +2 Query: 287 RSVLEILMEGHGVSGGGQSIFVTMKFAVLPIAKVFIMCFMGFLMASKYVNILSSDGRKLL 466 RS+LE+L G S+ +K+AVLPIAKVF +CFMGFLMASKYVNIL +GRKLL Sbjct: 4 RSLLEVLATAAQGGTEGTSVLSMLKYAVLPIAKVFTVCFMGFLMASKYVNILQPNGRKLL 63 Query: 467 N 469 N Sbjct: 64 N 64 >gb|AFK32351.1| putative auxin efflux carrier-like protein PINY [Zea mays] gi|414879968|tpg|DAA57099.1| TPA: hypothetical protein ZEAMMB73_854946 [Zea mays] Length = 433 Score = 75.1 bits (183), Expect = 6e-12 Identities = 38/61 (62%), Positives = 45/61 (73%) Frame = +2 Query: 287 RSVLEILMEGHGVSGGGQSIFVTMKFAVLPIAKVFIMCFMGFLMASKYVNILSSDGRKLL 466 RS+LE+L G S+ +K+AVLPIAKVF +CFMGFLMASKYVNIL +GRKLL Sbjct: 4 RSLLEVLATAAQGGTEGTSVLSMLKYAVLPIAKVFTVCFMGFLMASKYVNILQPNGRKLL 63 Query: 467 N 469 N Sbjct: 64 N 64