BLASTX nr result
ID: Dioscorea21_contig00017014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017014 (644 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002451347.1| hypothetical protein SORBIDRAFT_04g000510 [S... 57 4e-06 >ref|XP_002451347.1| hypothetical protein SORBIDRAFT_04g000510 [Sorghum bicolor] gi|241931178|gb|EES04323.1| hypothetical protein SORBIDRAFT_04g000510 [Sorghum bicolor] Length = 228 Score = 56.6 bits (135), Expect = 4e-06 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%) Frame = +2 Query: 44 LPHVMHVRDVRTPCLEETYTGSDICPGLVAAEAVSSLQIAEDSCEDPFLRNG-AASVVIN 220 LP V D++ P + T+ S CPG +AA+AVSSLQI E+S E G AA+ V+N Sbjct: 154 LPSWGEVSDLQGPYYQGTFHQSVTCPGFIAAQAVSSLQIREESSEITSPSQGAAAATVVN 213 Query: 221 RMLRGSNGGDKVNFYKK 271 RML G+N ++N Y++ Sbjct: 214 RMLGGTN---RLNLYRE 227