BLASTX nr result
ID: Dioscorea21_contig00016716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016716 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ84090.1| unknown [Medicago truncatula] 55 8e-06 >gb|ACJ84090.1| unknown [Medicago truncatula] Length = 135 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +1 Query: 13 LVTKDVDYIYRTPQSKENKIPEVGLSCPPPAPKKQRPVAVLCKRKL-SELEFFKVE-AEE 186 +V ++D YRTP SKE+KIPE+ C PPAP+K +P V CKRKL + +FF+V+ E+ Sbjct: 62 VVDGEIDESYRTPTSKESKIPEIH-DC-PPAPRKPKPF-VSCKRKLMDDFQFFEVKNNED 118 Query: 187 MDRLF 201 MD F Sbjct: 119 MDAFF 123