BLASTX nr result
ID: Dioscorea21_contig00016610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016610 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531873.1| methylenetetrahydrofolate dehydrogenase, put... 86 3e-15 ref|XP_002263128.2| PREDICTED: c-1-tetrahydrofolate synthase, cy... 84 1e-14 emb|CBI36823.3| unnamed protein product [Vitis vinifera] 84 1e-14 gb|ABK96126.1| unknown [Populus trichocarpa] 84 1e-14 ref|NP_001239823.1| uncharacterized protein LOC100783652 [Glycin... 83 2e-14 >ref|XP_002531873.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] gi|223528481|gb|EEF30510.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] Length = 299 Score = 85.9 bits (211), Expect = 3e-15 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = +3 Query: 129 EIADEVRSLSEKYGKVPGLAVVIVGTRKDSQSYVRMKRKACAEVGI 266 EIADEVR LSEKYGKVPGLAVVIVG RKDSQSYV MKRKACAEVGI Sbjct: 24 EIADEVRQLSEKYGKVPGLAVVIVGNRKDSQSYVSMKRKACAEVGI 69 >ref|XP_002263128.2| PREDICTED: c-1-tetrahydrofolate synthase, cytoplasmic [Vitis vinifera] Length = 307 Score = 84.0 bits (206), Expect = 1e-14 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +3 Query: 129 EIADEVRSLSEKYGKVPGLAVVIVGTRKDSQSYVRMKRKACAEVGI 266 EIA+EVR LSEKYGKVPGLAVVIVG RKDSQSYV MKRKACAEVGI Sbjct: 24 EIAEEVRHLSEKYGKVPGLAVVIVGNRKDSQSYVSMKRKACAEVGI 69 >emb|CBI36823.3| unnamed protein product [Vitis vinifera] Length = 271 Score = 84.0 bits (206), Expect = 1e-14 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +3 Query: 129 EIADEVRSLSEKYGKVPGLAVVIVGTRKDSQSYVRMKRKACAEVGI 266 EIA+EVR LSEKYGKVPGLAVVIVG RKDSQSYV MKRKACAEVGI Sbjct: 24 EIAEEVRHLSEKYGKVPGLAVVIVGNRKDSQSYVSMKRKACAEVGI 69 >gb|ABK96126.1| unknown [Populus trichocarpa] Length = 299 Score = 84.0 bits (206), Expect = 1e-14 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +3 Query: 129 EIADEVRSLSEKYGKVPGLAVVIVGTRKDSQSYVRMKRKACAEVGI 266 EIA+EVR LSEKYGKVPGLAVVIVG RKDSQSYV MKRKACAEVGI Sbjct: 24 EIAEEVRQLSEKYGKVPGLAVVIVGNRKDSQSYVGMKRKACAEVGI 69 >ref|NP_001239823.1| uncharacterized protein LOC100783652 [Glycine max] gi|255647576|gb|ACU24251.1| unknown [Glycine max] Length = 294 Score = 83.2 bits (204), Expect = 2e-14 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 129 EIADEVRSLSEKYGKVPGLAVVIVGTRKDSQSYVRMKRKACAEVGI 266 EIADEVR LS+KYGKVPGLAVVIVG RKDSQSYV MKRKACAE+GI Sbjct: 17 EIADEVRQLSQKYGKVPGLAVVIVGNRKDSQSYVGMKRKACAELGI 62