BLASTX nr result
ID: Dioscorea21_contig00016600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016600 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464018.1| hypothetical protein SORBIDRAFT_01g010630 [S... 70 2e-10 ref|XP_003560760.1| PREDICTED: phytanoyl-CoA dioxygenase domain-... 68 9e-10 tpg|DAA50923.1| TPA: hypothetical protein ZEAMMB73_050535 [Zea m... 67 2e-09 ref|NP_001141316.1| uncharacterized protein LOC100273407 [Zea ma... 67 2e-09 gb|ADP02208.1| PhyH domain-containing protein [Triticum aestivum] 66 3e-09 >ref|XP_002464018.1| hypothetical protein SORBIDRAFT_01g010630 [Sorghum bicolor] gi|241917872|gb|EER91016.1| hypothetical protein SORBIDRAFT_01g010630 [Sorghum bicolor] Length = 282 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 295 PSSRHALSLHAVDTYGCSWIKDNWIQRKVDPEPLYVS 185 P+SRHALSLH VDT GC W KDNWIQRK PEPLYVS Sbjct: 246 PASRHALSLHVVDTEGCEWSKDNWIQRKTAPEPLYVS 282 >ref|XP_003560760.1| PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1-like [Brachypodium distachyon] Length = 282 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -3 Query: 295 PSSRHALSLHAVDTYGCSWIKDNWIQRKVDPEPLYVS 185 P SRHALSLH VDT GC W KDNWIQRK PEPLYVS Sbjct: 246 PVSRHALSLHVVDTEGCKWSKDNWIQRKSAPEPLYVS 282 >tpg|DAA50923.1| TPA: hypothetical protein ZEAMMB73_050535 [Zea mays] Length = 267 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 295 PSSRHALSLHAVDTYGCSWIKDNWIQRKVDPEPLYVS 185 P+SRHA SLH VDT GC W +DNWIQRK PEPLYVS Sbjct: 231 PASRHAFSLHVVDTEGCKWSEDNWIQRKTAPEPLYVS 267 >ref|NP_001141316.1| uncharacterized protein LOC100273407 [Zea mays] gi|194703946|gb|ACF86057.1| unknown [Zea mays] gi|414872368|tpg|DAA50925.1| TPA: hypothetical protein ZEAMMB73_050535 [Zea mays] Length = 282 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 295 PSSRHALSLHAVDTYGCSWIKDNWIQRKVDPEPLYVS 185 P+SRHA SLH VDT GC W +DNWIQRK PEPLYVS Sbjct: 246 PASRHAFSLHVVDTEGCKWSEDNWIQRKTAPEPLYVS 282 >gb|ADP02208.1| PhyH domain-containing protein [Triticum aestivum] Length = 281 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -3 Query: 295 PSSRHALSLHAVDTYGCSWIKDNWIQRKVDPEPLYVS 185 P SRHALSLH VD GC W KDNWIQRK PEPLYVS Sbjct: 245 PVSRHALSLHVVDMEGCKWSKDNWIQRKTAPEPLYVS 281