BLASTX nr result
ID: Dioscorea21_contig00016553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016553 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006532352.1| cobalamin biosynthesis protein CobW [Pseudom... 62 5e-08 ref|YP_005930127.1| CobW [Pseudomonas putida BIRD-1] gi|31349855... 62 5e-08 ref|YP_004486244.1| cobalamin biosynthesis protein CobW [Delftia... 62 6e-08 ref|YP_001418173.1| cobalamin biosynthesis protein CobW [Xanthob... 62 6e-08 ref|ZP_11388860.1| putative GTPase, G3E family [Oscillatoriales ... 61 8e-08 >ref|YP_006532352.1| cobalamin biosynthesis protein CobW [Pseudomonas putida DOT-T1E] gi|397331201|gb|AFO47560.1| cobalamin biosynthesis protein CobW [Pseudomonas putida DOT-T1E] Length = 381 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = -2 Query: 230 CRPSDRRPGRSAG*TCGRMACTLVTGFLGSGKTTLLRHILDNRGDLRIAVLVNEF 66 C P+ G+ T ++ T+VTGFLGSGKTTLLRH+LDN RIAV+VNEF Sbjct: 15 CMPAPHCQGQCDMKTLAKLPVTIVTGFLGSGKTTLLRHMLDNAQGRRIAVIVNEF 69 >ref|YP_005930127.1| CobW [Pseudomonas putida BIRD-1] gi|313498556|gb|ADR59922.1| CobW [Pseudomonas putida BIRD-1] Length = 381 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = -2 Query: 230 CRPSDRRPGRSAG*TCGRMACTLVTGFLGSGKTTLLRHILDNRGDLRIAVLVNEF 66 C P+ G+ T ++ T+VTGFLGSGKTTLLRH+LDN RIAV+VNEF Sbjct: 15 CMPAPHCQGQCDMKTLAKLPVTIVTGFLGSGKTTLLRHMLDNAQGRRIAVIVNEF 69 >ref|YP_004486244.1| cobalamin biosynthesis protein CobW [Delftia sp. Cs1-4] gi|333742712|gb|AEF87889.1| cobalamin biosynthesis protein CobW [Delftia sp. Cs1-4] Length = 349 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 179 RMACTLVTGFLGSGKTTLLRHILDNRGDLRIAVLVNEF 66 ++ T+VTGFLGSGKTTLLRHILDN G RIAV+VNEF Sbjct: 5 KIPATIVTGFLGSGKTTLLRHILDNAGGRRIAVIVNEF 42 >ref|YP_001418173.1| cobalamin biosynthesis protein CobW [Xanthobacter autotrophicus Py2] gi|154161300|gb|ABS68516.1| cobalamin biosynthesis protein CobW [Xanthobacter autotrophicus Py2] Length = 344 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -2 Query: 179 RMACTLVTGFLGSGKTTLLRHILDNRGDLRIAVLVNEF 66 R+ CT+VTGFLG+GKTTL+RH+L+N G R+AV+VNEF Sbjct: 6 RVPCTIVTGFLGAGKTTLIRHVLENAGGKRLAVIVNEF 43 >ref|ZP_11388860.1| putative GTPase, G3E family [Oscillatoriales cyanobacterium JSC-12] gi|410712476|gb|EKQ69977.1| putative GTPase, G3E family [Oscillatoriales cyanobacterium JSC-12] Length = 361 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 176 MACTLVTGFLGSGKTTLLRHILDNRGDLRIAVLVNEF 66 M T++TGFLGSGKTTLL HIL+NR DL++AVLVNEF Sbjct: 20 MPVTIITGFLGSGKTTLLNHILNNRHDLKVAVLVNEF 56