BLASTX nr result
ID: Dioscorea21_contig00016517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016517 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546077.1| PREDICTED: F-box protein At5g46170-like [Gly... 62 5e-08 ref|XP_003593894.1| F-box family protein [Medicago truncatula] g... 60 2e-07 ref|XP_003542943.1| PREDICTED: F-box protein At5g46170-like [Gly... 59 3e-07 ref|NP_199429.1| F-box protein [Arabidopsis thaliana] gi|7526276... 59 5e-07 ref|XP_002863421.1| F-box family protein [Arabidopsis lyrata sub... 59 5e-07 >ref|XP_003546077.1| PREDICTED: F-box protein At5g46170-like [Glycine max] Length = 385 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +1 Query: 10 EQQPRDIGGGSEGFSWVSGVFEEPYRSAARLLVKRRTYCLEMNSF 144 EQ P + SWVS FEEPYR+AA +LVKRRTYCLEMNSF Sbjct: 341 EQSPNTAKKEASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF 385 >ref|XP_003593894.1| F-box family protein [Medicago truncatula] gi|355482942|gb|AES64145.1| F-box family protein [Medicago truncatula] Length = 389 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +1 Query: 34 GGSEG--FSWVSGVFEEPYRSAARLLVKRRTYCLEMNSF 144 G EG SWVS FEEPYRSAA +L+KRRTYCLEMNSF Sbjct: 351 GKKEGSDLSWVSTAFEEPYRSAAAMLIKRRTYCLEMNSF 389 >ref|XP_003542943.1| PREDICTED: F-box protein At5g46170-like [Glycine max] Length = 387 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 10 EQQPRDIGGGSEGFSWVSGVFEEPYRSAARLLVKRRTYCLEMNSF 144 E P + SWVS FEEPYR+AA +LVKRRTYCLEMNSF Sbjct: 343 ELSPNTAKKEASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF 387 >ref|NP_199429.1| F-box protein [Arabidopsis thaliana] gi|75262767|sp|Q9FNK5.1|FB285_ARATH RecName: Full=F-box protein At5g46170 gi|9757737|dbj|BAB08262.1| unnamed protein product [Arabidopsis thaliana] gi|17979207|gb|AAL49842.1| unknown protein [Arabidopsis thaliana] gi|23296883|gb|AAN13195.1| unknown protein [Arabidopsis thaliana] gi|332007966|gb|AED95349.1| F-box protein [Arabidopsis thaliana] Length = 395 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 52 SWVSGVFEEPYRSAARLLVKRRTYCLEMNSF 144 SWVS FEEPY +AA++LVKRRTYCLEMNSF Sbjct: 365 SWVSSAFEEPYETAAKMLVKRRTYCLEMNSF 395 >ref|XP_002863421.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297309256|gb|EFH39680.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 392 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 52 SWVSGVFEEPYRSAARLLVKRRTYCLEMNSF 144 SWVS FEEPY +AA++LVKRRTYCLEMNSF Sbjct: 362 SWVSSAFEEPYETAAKMLVKRRTYCLEMNSF 392