BLASTX nr result
ID: Dioscorea21_contig00016511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016511 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB85863.1| unnamed protein product [Silene latifolia subsp.... 60 1e-07 >dbj|BAB85863.1| unnamed protein product [Silene latifolia subsp. alba] Length = 285 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = +3 Query: 6 FGLSSVSRINQEMFLFHFDNELGCDQLLAEGPFTFDNHPLIFRKWQPRLNMDMA-ACVLP 182 +G+ VS ++ E+FL F + + LL G + FDN PLI R W P ++ A V+P Sbjct: 134 YGVGRVSFLSSEVFLVRFRKQKYMEALLHHGHYVFDNRPLIVRPWTPNESLTKAEITVVP 193 Query: 183 IWIQLPGLPWEFW 221 +W++L LP +FW Sbjct: 194 VWVRLLNLPLKFW 206