BLASTX nr result
ID: Dioscorea21_contig00016070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016070 (692 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450488.1| hypothetical protein SORBIDRAFT_05g006090 [S... 108 1e-21 ref|XP_002510291.1| conserved hypothetical protein [Ricinus comm... 105 6e-21 ref|XP_004147830.1| PREDICTED: B3 domain-containing protein Os01... 102 7e-20 emb|CBI19591.3| unnamed protein product [Vitis vinifera] 100 2e-19 gb|AFW60660.1| hypothetical protein ZEAMMB73_443682 [Zea mays] 100 5e-19 >ref|XP_002450488.1| hypothetical protein SORBIDRAFT_05g006090 [Sorghum bicolor] gi|241936331|gb|EES09476.1| hypothetical protein SORBIDRAFT_05g006090 [Sorghum bicolor] Length = 443 Score = 108 bits (269), Expect = 1e-21 Identities = 59/132 (44%), Positives = 73/132 (55%) Frame = +2 Query: 47 AAGARGMASFRCPSFFKVFLPNLSAQHLKIPPAFLKHIVHEEEARTVSLEGPSGSVWCVE 226 AAGA + CP FFKVF P LS + LKIPP F +H+ E+ VSL GPSG W Sbjct: 49 AAGAGNV----CPQFFKVFFPELSGERLKIPPMFRQHL-QEQPTGPVSLRGPSGKKWQAT 103 Query: 227 MVRNSGGVWFENGWKEFVADHSVVMGDFLVFCYTGDSSFRVSLFDSTACQKEAAFCARPS 406 + S +FE GWKEFV DHS+ G FLVF Y G S F V +F + A A+P+ Sbjct: 104 LASESEAWFFEQGWKEFVTDHSINKGYFLVFTYDGPSQFSVVVFSPSGVTDPIALKAKPT 163 Query: 407 QAATVLGEDIDE 442 V E+ +E Sbjct: 164 NEVVVKIEEDEE 175 >ref|XP_002510291.1| conserved hypothetical protein [Ricinus communis] gi|223550992|gb|EEF52478.1| conserved hypothetical protein [Ricinus communis] Length = 567 Score = 105 bits (263), Expect = 6e-21 Identities = 54/134 (40%), Positives = 81/134 (60%), Gaps = 7/134 (5%) Frame = +2 Query: 77 RCPSFFKVFLPNLSAQHLKIPPAFLKHIVHEEEART---VSLEGPSGSVWCVEMVRNSGG 247 R P FF++F NLS+ L+IP F +H+ E RT VSL GPSG++W V +++ S Sbjct: 14 RRPCFFEIFSSNLSSDRLRIPARFTRHL----EGRTSGSVSLTGPSGNIWTVNLIQQSED 69 Query: 248 VWFENGWKEFVADHSVVMGDFLVFCYTGDSSFRVSLFDSTACQKEAAFCAR----PSQAA 415 ++F++GW FV DH + GD L+F + G+ F V +FD + C+KEAAF ++ P Q Sbjct: 70 IFFDHGWPVFVKDHFIACGDLLLFRFDGELCFTVQVFDQSKCEKEAAFHSKCTQNPIQFY 129 Query: 416 TVLGEDIDEDDCKD 457 +G+ + DD D Sbjct: 130 ISIGQKRERDDGDD 143 >ref|XP_004147830.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Cucumis sativus] Length = 580 Score = 102 bits (254), Expect = 7e-20 Identities = 52/129 (40%), Positives = 78/129 (60%) Frame = +2 Query: 59 RGMASFRCPSFFKVFLPNLSAQHLKIPPAFLKHIVHEEEARTVSLEGPSGSVWCVEMVRN 238 R M + R PSF+ + LS++ LK+P F+KH+ E R+V L GPSG W V +++ Sbjct: 8 REMVAARRPSFYTFYSSTLSSERLKLPLKFVKHL-EEIIGRSVVLIGPSGQTWHVNLIQE 66 Query: 239 SGGVWFENGWKEFVADHSVVMGDFLVFCYTGDSSFRVSLFDSTACQKEAAFCARPSQAAT 418 + ++F +GW F DH++ GDFLVF Y + +F V +FD +AC+KE AF ++ Q T Sbjct: 67 NDNLFFCDGWPTFARDHALECGDFLVFRYDSELNFNVQVFDQSACEKEGAFLSQFRQDNT 126 Query: 419 VLGEDIDED 445 D +ED Sbjct: 127 GHKRDREED 135 >emb|CBI19591.3| unnamed protein product [Vitis vinifera] Length = 604 Score = 100 bits (250), Expect = 2e-19 Identities = 52/118 (44%), Positives = 75/118 (63%), Gaps = 3/118 (2%) Frame = +2 Query: 65 MASFRCPSFFKVFLPNLSAQHLKIPPAFLKHIVHEEEART---VSLEGPSGSVWCVEMVR 235 M + + P FF+VF P+ S++ LKIP F+KH+ E RT VSL GPS + W V++++ Sbjct: 1 MKNSKRPHFFEVFQPDASSERLKIPSRFIKHM----EGRTSGFVSLVGPSDNTWHVDLIQ 56 Query: 236 NSGGVWFENGWKEFVADHSVVMGDFLVFCYTGDSSFRVSLFDSTACQKEAAFCARPSQ 409 + + +GW FV DH + GD LVF Y G+ F V +FD ++C+KEAAF A+ SQ Sbjct: 57 QNSDLLLHDGWPVFVRDHCIECGDSLVFRYDGNLHFTVQVFDRSSCEKEAAFHAKCSQ 114 >gb|AFW60660.1| hypothetical protein ZEAMMB73_443682 [Zea mays] Length = 411 Score = 99.8 bits (247), Expect = 5e-19 Identities = 50/112 (44%), Positives = 66/112 (58%), Gaps = 3/112 (2%) Frame = +2 Query: 80 CPSFFKVFLPNLSAQHLKIPPAFLKHIVHEEEARTVSLEGPSGSVWCVEMV--RNSGGVW 253 CP FFKVF P S + L+IPP F +H+ ++ VSL GPSG+ W + S W Sbjct: 97 CPQFFKVFFPEQSTERLRIPPMFNQHLKEQQPTGAVSLRGPSGNRWQAALASESESEAAW 156 Query: 254 -FENGWKEFVADHSVVMGDFLVFCYTGDSSFRVSLFDSTACQKEAAFCARPS 406 F+ GWKEFV DHS+ +G FLVF G + F V++F S+ AA ARP+ Sbjct: 157 CFDQGWKEFVTDHSLRLGHFLVFTRDGPAQFSVAVFSSSGVIDPAALDARPT 208