BLASTX nr result
ID: Dioscorea21_contig00015941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00015941 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162168.1| PREDICTED: polypyrimidine tract-binding prot... 74 2e-11 ref|XP_002264763.2| PREDICTED: polypyrimidine tract-binding prot... 74 2e-11 ref|XP_002264689.2| PREDICTED: polypyrimidine tract-binding prot... 74 2e-11 ref|XP_003536416.1| PREDICTED: polypyrimidine tract-binding prot... 74 2e-11 ref|NP_001242751.1| uncharacterized protein LOC100819672 [Glycin... 74 2e-11 >ref|XP_004162168.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like [Cucumis sativus] Length = 432 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 111 MTEPSKVIHIRNVGHEITENDLLQLLQPFGVVTKIVML 224 MTEPSKVIH+RNVGHEI+ENDLLQL QPFGV+TK+VML Sbjct: 1 MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVML 38 >ref|XP_002264763.2| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 2 [Vitis vinifera] Length = 432 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 111 MTEPSKVIHIRNVGHEITENDLLQLLQPFGVVTKIVML 224 MTEPSKVIH+RNVGHEI+ENDLLQL QPFGV+TK+VML Sbjct: 1 MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVML 38 >ref|XP_002264689.2| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 1 [Vitis vinifera] Length = 445 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 111 MTEPSKVIHIRNVGHEITENDLLQLLQPFGVVTKIVML 224 MTEPSKVIH+RNVGHEI+ENDLLQL QPFGV+TK+VML Sbjct: 1 MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVML 38 >ref|XP_003536416.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like [Glycine max] Length = 443 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 111 MTEPSKVIHIRNVGHEITENDLLQLLQPFGVVTKIVML 224 MTEPSKVIH+RNVGHEI+ENDLLQL QPFGV+TK+VML Sbjct: 1 MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVML 38 >ref|NP_001242751.1| uncharacterized protein LOC100819672 [Glycine max] gi|255639782|gb|ACU20184.1| unknown [Glycine max] Length = 431 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 111 MTEPSKVIHIRNVGHEITENDLLQLLQPFGVVTKIVML 224 MTEPSKVIH+RNVGHEI+ENDLLQL QPFGV+TK+VML Sbjct: 1 MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVML 38